eon3122000755 000000 000001 00000000000 05710547122 012210 5ustar00rootother000000 000000 eon3122/bin000755 000000 000001 00000000000 05710546646 012772 5ustar00rootother000000 000000 eon3122/bin/ec1000755 000000 000001 00000612004 05710535131 013435 0ustar00rootother000000 000000 d0K-̀\ `D$4 `h P< t P`[̀UWVS] {h8j `R軁EPh` `}~$s0u6j `hxv4hxSEP4EtU9|6j`hEPEh`c[ ``g 9u`cQh` `h0h` `jh``$uh`h!0+z=xth`h`h40` =xt hG0i`U9U}`E4p>0щMQ`ERPK ` =xtPhR0`EU9U|AhW0h`U`ƃu< `Ph`h`hY0Ny0ɿ`щMƁ]h`chX]Rh`]=xthXh`hx0b` V&V9`SO =tv=t%Ph0h ``j`j`UE@f8u@P(]Ðh`h0h `P`]ÐU WVS]EEf;th0hh0h0SR[h0SR}Ehx4j=x%PRN3}+PRh0h ``h9t0P:pmVh ` tVhh+1Zw { tC f8?uEUR 0RjjhQ1Cf8u P+R1PUR0R0Rhhh`hXK=g43Ph`hS1h `_h1;XCf8dujP 0Cf84ujP`51 tG51t051th1h1XRd { tC f8?u PS$RqjSRVS(R}(hX/A=0tEE=0tED}t 0UR 0R0Rjh1Cf8u P*1PUR0R0Rhhh`hX;g4~3e[^_]ÐUS]f;uSRE @P[ S]]ÐUEfffvh1hyh2h2 ]US]fffv)fffvh%2hh2h2f;uSh2xjSRPh`hXh`t h2ttGt Xt;C00$00]]ÐUWVS]1f;duHgRp*po[SR7[ Ff;gt9t 0oe[^_]ÐU@WVS}f?hth3hh(3h.3qjWRyP]Sy`SW0u%ShL3hxg`hxgWju 0SgRiUƃtVEP&`E0G f8kuPƃ3V]SXRTVS?mSEP`t 0e[^_]ÐUEf8th3hh3h3f]ÐUEf8ku$j@Ph s ]Ð1]ÐUEf8th3hh3h3]ÐUWVSUf:u 1Ef8t'h4hxgc`hxgURjt.E@PKƃ0ɉ1ۃt[EPPBKǃuURh%4[u..Wh?4h `_] 0щʃ9rhB4h `_e[^_]UWVSE} 1f84uÐWFVSR[ f;4te[^_]ÐUWVSMf95thE4h3h]4hc4jURRSqj:Sv`ǃt G4}tMQU RPhU RP9SeSa1ۃ M9N~U RL QBC9^WSXRq]MQU RSMI Q[^_]ÐUWVSE} ~pPAtcBÅtU{Hru#WCdPsVA- tVh4Wo{SYujCHPC'PCP".뭐e[^_]ÐUVS]u f;8uY}tV[ SoGURVSRBj# 7VSRqj.6V[S$j"6e[^]ÐUEf8;uURU RP]ÐUWVS]} uf;;uVWSR VW[ Se[^_]ÐUWVSuf>MuGSWVRP ;~$h5hxg_hxgVj)n)SWE @Pv Ve[^_]ÐUWVS]u1f;Nth5hh6h 6 Sf:uPjRR ǃ S f:Pu!P,*f:RPjR 19=0uP gQ9=;19}P ;C9|=0uj=u 0 jMP gQ8:;P\_=F9S19}P1_F9|鍥[^_]ÐUEf8Ru U RP ]ÐUWVS} Mf9RufqV]SWj.S*t%Sh+6hxg_hxgVjvl&h`6jYSWjuXRYWMI Qt[^_]ÐUEf8Ru U RP ]ÐUWVS} Mf9RqV]Sha6jNSWjdXR\Y Wj"SD) t%Shb6hxg_hxgVjk &W2SP\à t6{[Yt Q@2C[YC\S?jCHPC'PCP'WUR R/t[^_]ÐUUf:RuPjR]ÐU WVS] uUf:Quj _uj h6AEPMIQ}tG0}P_MQP(_UR_VCPMI QHÍe[^_]ÐUWVSuDž|ff»fv)fffvh6hh7h7o EF Et)H'I^  HtUFtoIt;\j[ SmPEP_F @P|'SptPEP_U B ]0щtQ$_tU u"0щtQh97?SU Rl_E @ YjV RltP]S!_0щtQ_tU u"0щtQhM7"?SU R_vV| "VotP]S_0щtQ_tU u"0щtQha7>SU R\_E @ Y@VotP]S&_0щtQ_tU u"0щtQhu7>SU R_E @ Y@ Vh7h||:tz0ۋ|щtQ_tU Bu%|щʃRh7m=|PU RR+_E @U RMttE th[^_]ÐUS]f;?uSR[ S]]ÐUS]f;@th7h h7h7f[ S]]ÐUWVS}f?Rwf>FunjV RiP]S5_S%uYSh7hxg_hxgVjfe=cthch-8h `R_ Vh08f WYt[^_]ÐUWVSu Uf:u |j _Muj hH8;jURRgn0P_USMP,_URFPMI Qlƍe[^_]UVS1 gQ4t&4tPH `PtF吐]f;uKQ)Ƌ[ f;tt 0e[^]ÐUS]U Ft Et7@HtIt/jR Rg RkPS?_ RhY8e]]ÐUVS]1f;thu8hzh8h81Cf8u@P]f8u h80[ f;!uSRk([ f;!te[^]ÐUS]f;u jSRfP;0[ f;t]]ÐU8WVSDžDžDžNƅUf:"th8hh8h8MA pf8#uf>(u FPjURR (t=Cڃv5%t0Ph9hxg _hxgMQja)pjDPgR.PMA @P PEP&_}u'9U +9M=0uTpR gQ1ƃt*F'PP_VHƅƅ(u1Mq F@f8u DžYPEPV Dž&t-%'t;(tFUB @ƅC@P'}ƅUhu,91t FO)ƅFu8ƅR/ƅAMQh19aUB @PMB91t FO)ȃtR gQ?Ft Rk19hG9j*P uQPhH9hxge_hxgMQj+!_=cthcho9h ` _ aSPUR Rj }*u8Eƿr9t"P"tPhz9Q_ =0u2PR_u8t 0xt @ PENjQPPP^WRu =0tERPN`uYPN_uYPN^uYPQPXPN~YPRPPA PR XQKPC919h9j*Pf uQPh9hxg_hxgURj+\=cthch9h `_ xt@Puǃ=0u,PS_u8t 0SPPP\WQu =0tERPu9PRSPPA PR XQKU URURgRP< tFPUR\_t 0U RBU URURURgR;9[ fffE e[^_]ÐUS]fffvh;hhD;hJ;f;*t U R[S ]]ÐUVS]u fffv8hh;h"h;h;kVSR[ f;0ue[^]ÐUWVS]Ef;ath;h1h;h< EPK Q‰ֿ#<E M1t FO)ȃuU R gQ6 ;Q;[S e[^_]ÐUVS]u f;tUf;tGh0<hDha<hg<j)VjjLjSRYPS[ f;uٍe[^]UWVS]Ef;u<l^$$)D))$*4*T*jsVMYPh _C f8h<h _EP0  Ps VLX[ SjsVXPh V_C f8u>h<h _EP0  Ps VW[ S_u d5<5 Rj[S]XPh _8[SgPh<Rh<h ,_ e[^_]ÐUUf:%t&t(uMQMQM QR]ÐUWVS]f;(th<hh<h<h<SRu <U RSRS RURU RURSRUR[S_e[^_]ÐUS]fffv)fffvh<hhZ=h`=r^t~_uURURS]]ÐUS]fffv#f;th~=hh=h==t/ =tD=t)7=+=jSPV1]]ÐUWVS]uf;_th=hh>h>kC@P^PPo_C f8uP(WPEPR_ EU0tӋM QPSV[^_]ÐUVS]f;tuo=t=u[f;uTS f:uJEPR=ƃ}~5Tf;uNPh:>MQV pQ gQ?8V_e[^]ÐUVS]ff]fwo=t=u[f;uTS f:uJEPRƃ}~5Ef;uNPh<>MQV pQ gQ7V}_e[^]USEf8uBP f:u8EPR;Ã}~#jNh>>MQSh@> gQO7S!_]]ÐU@WVShL>jWRhN>V_Ãu < `QVh`hP>LURSS_EPV_u < `QVh`h>zLURz_NjUԋM h>V=_à u&Wf_V_ < `QVh`h>-LSU RjW/_Sq_V_e[^_]ÐUWVS]}uf;uVWU RSRVWU R[ Se[^_]ÐUS]f;uSR[ S0]]ÐUEf8ujP[]ÐU]ÐUVSuf>t>F>oCP_uSh>$RvVR ËR_؍e[^]ÐUWVSUր:tfs^> uKFRSpt*0щȃf>f>C F>trRSe[^_]ÐUWVSu F> t> tjh>V_ u F> t> t0Ѓ9v8 t8 uH9w)CPVUR_؍e[^_]ÐUWVSUс$T23$4443D4d4t44444444225555d3>i>URRWƃ0ɉ1ۃ(EPP"ǃuURh>LWh_]0щʃ9rjEP-OEEUJ zuQh?h _xE@PVE0ɋ}щMUD EPBR!à uURh? LSh _ 1?6?Epp hS|4FPMQ'_xFPM Q _xtFPM QhLAh `]_}Lu`f~PuE PhkAM QF9EuRhAhxg5_hxgWj1<Zf~Pu)M QhAhxg_hxgWj1'E PhBhxg_hxgWj3<6j_ƍ]0҉xRz_xFSP_} 0҉xRM_xFE PxQ_fEfFfMfNfEfF| |41l[^_]ÐUVSURhQBuV_V<VtSRV_uC u1x[^]ÐUSURU RhVB]Sl_S%|]ÐUVSuV;VLt$SRV~_u u1e[^]ÐUSU1ɀ:t B:uȻXЋ]]ÐUX!=}]ÐUj%]ÐUWVS1t\C9EuAt  SRG_SR>_S8_ t빐ދ몐X!~e[^_]ÐUURh[B'7]ÐU币B]ÐUWVSjURgRPgR 0uJcRV(=ptpRV;ue[^_]ÐU]ÐU]ÐU]ÐU1]ÐU]ÐUhB5]ÐUWVS]EU RSǃu:St'1ۃU9V~U RT RrǃCu 9^ttE򐐋Ee[^_]ÐUEf8u @P ]ÐUVSuf>u:jVRS6j:SE_tSgRv V[^]ÐUSURS_S8SShBd4eP ËSHRRSHRR0SHRR#SHRR$SHRR SHRR= SHRSa]ÐUWVSj_EB\!ujhB} 0ۋ}щMQ_E B\! \!M9u }щMQhB } щMQP_E B\!B \!Myu } щMQhB }щMQ_E B\!B \!Myu }щMQhBc }щMQ蔿_E B\!B \!My u }щMQhB uVB\!0V_E P5B4\!FP_uVB\!pV_EP5B4\!F Pq_Be[^_]ÐUVS195B~u\!;t_8t P贺_xt @P蠺_xt @P茺_x t @ Px_Rm_F95BBe[^]ÐUB]ÐUE\!]ÐUWVS]} 9CuWCR__uCC&Wh&M_WS t tU'PS"1ۃ9^~4WT R tC t'PC9^΃=Cu hCe[^_]ÐUWVSM CC&M Qh&_1ۃ9C~C"0 CtMQPM QMQUh UC9Ce[^_]ÐUWS]j膼_C"ujh$C 0щMQL_E C" "M9u0щMQh/CSC"P|_Ce[_]ÐUVS195C~9";t#8t P_R起_F95CCe[^]ÐUC]ÐUE"]ÐUWVS195C~r"PMQ_t-P]NjMQRP1҃ 9P~$9| u#B9PރF95C1e[^_]ÐU WVSEEE9C~M"$80щMQs_ERPE_ EE9CE Ce[^_]ÐUVS19 C~$P_C9 Ce[^]ÐUWVSC9 Ct1EM9 CE"M0:C19 C~q$QMPо_tR}t@QƋMPP*1҃ 9P~9p tB9P~9t u9Pu C9 C9 C+EEM9 CEe[^_]ÐUWS] EE0҉߈1҃t2E8u#B0щȃ9r1e[_]ÐUWVS1EPÃu 0DShDE PhD`_S>ƒ~pFÅt0u19}+] SpPNlmG9|1`[^_]ÐUVSu] V'tSh*V*؍e[^]ÐUWVSu ujEPj:UR Ãtv;td;tC;>uPVUR>C !SUR&uPVM_0Ѓ:Ft ;p9utFe[^_]ÐUVSjURgRY PgRƋcRV&=ptpRV;ue[^]ÐUVSjURgR ƋcRV~'=ptpRV_;ue[^]ÐUWVEƿDtrƿD t_ƿ DtLƿ(Dt9ƿ-Dt&ƿ4Dtƿ8Du1e^_]ÐUWVS}@C\CRWW_u 9v1e[^_]ÐUWVS}CCRW_u 9v1e[^_]ÐUWVSu@C\CRV跹_t$9v黸CCRV蓹_u 9v1e[^_]ÐUWVS}1۾@CRWK_uCv׸e[^_]ÐU]ÐUS]| 9|h=DhAh]DhkD@C]]ÐUU RURhD+&]ÐUWVSu01ۃt/>t>/uD+uV芦_w90~,Vr_PhDhl,j_CM 1l,e[^_]ÐUWVSEEEu0ҋ}1ۃtEEPEP%ƒtEPRV _ u]}0щȃ9rEe[^_]UWVSM QMQ_uDuM Q2MQGÃt.M Q5ƒtC9CM Qj:5u }G?t?:uM F>t>:uM QMQMt}OMNM >t?u>%\SMQÃMQhDS?ËM Q19S~ 9D tB9S1e[^_]ÐUVSu] ;%u S;*uBCPVu,Wj'PVPh,=_6}u:1Ҁ;:t;t؊,@B8:t8uƂ,, ؍e[^]ÐUWVS]}uM M1҉؀;t,8 t-@B8tM8u8t tƂ-t8uD-e[^_]ÐUWVS]} ?*t\PW$_EtFjh(EW]_ t2jWSyƃ t 0҉t V7PSe[^_]ÐUWVS}U RV~/{Åt!CPW苮_u7VtPWÃu  u1e[^_]ÐUU RUR`t ]Ð1]ÐUWVS]} j/WX_uj/WI_txWS_0Ѓ~+؉ƿ-Etƿ0EuSAe[^_]ÐU=4Eu!4E%4EH 4E4E]ÐUVS]u VSu CftCCe[^]ÐUE@]ÐUUR$@]ÐUEU DP]ÐUVS] uV1Ƀ9H~TH9u RA9H1e[^]ÐUSM] 19Q~%DQ9uB9Q1]]ÐUWVS} URN1ۃ9^~8D^P!WP_ uD^C9^1e[^_]ÐUWVS]S EESPz1 M9y~ZUT Rƃt&19^~3D^PMQ C9^UT RMQGU9zEe[^_]ÐUVSuU R+t#PSV uSVՐe[^]ÐUMPb9t 9~1]ÐUSPb;u Se9~hPLP]]UWVSu19d~)-@PV$_%C9dj莤_d-ujhd"0ۉщMQR_E d-B -MyuщMQhd} щMQ_E d- -M9u } щMQhdhVd-BP"_U Rd-R _de[^_]ÐUVS195d~M-;t7xt @PJ_8t P8_R-_F95dde[^]ÐUd]ÐUE-]ÐUWVS=gulgURǃe/9>u$RUR_uev1e[^_]ÐUWVS/e/R 9ve[^_]ÐUWVSu101ۃt!2B0щȃ9r؍e[^_]ÐUWVS}1= gt%1ېgRW_t F guߍv g gt#TM TMD6hlkh `1_h `W6_hkh `_1e[^_]ÐUWVSM]1҃= gt9 gt gB8t9uR g gu 1;|u >|u>u Dt D D e[^_]ÐUWVS]u }SISEP; Ht-IuZk/k/fkf/2k/k/fkf/k/0}1ۃt1ɀ=4jt24j8D+t4jA?t8D+u4juT+tƅu8jPhkV膤_ Vh/Ȥ_C0}Ѓ9p/h[^_]ÐUE4|$iiiiiiiiiiiiiiiiiiiii]ÐE ]Ð1]ÐUE==| ]Ð1]ÐUVSu1Vu jVt؍e[^]ÐU WVSE} 8@t8#t 8|t8&u 1P]SSH%؉ƃ v gt(ÐgREP_t F gu܍v guDHtj gP- gP%e[^_]UUE 8t8\u@ B@8u]ÐUUE 8t8\u\B @B8u]ÐUVS]u VSuCt CUCe[^]ÐUE@]ÐUUR@]ÐUUE D ]ÐUS] MQ@1҃9P~9\ uS B9P1]]ÐUUM =hu$19B~9L u]Ð@9B1]ÐUWVS} UR1ۃ9^~8T R"WP_ uD C9^1e[^_]ÐUhURh]ÐUWVS]Sǃ<ljSWEM9O~kUT Rƃt619^~@QT RW C9^ML QW"EU9We[^_]ÐUWVSu} W tGPq~:WPVR t#PMSV uWSѐe[^_]ÐUM1Ҹk9t ,B ~1]ÐUS1k;uS <,@ ~=ktk1,|uhkk]]ÐUS]K?19S~4| t&9t"D 9D u9uD B9SIy‹]]ÐU WVS}u p}W`\1X0gX0j} Wh`0dMjS\1'PPM\1@d\1JfxfzP\1@[N\1Hf={f8U9ga} WÃ{\1X0gX0jWh`0LjS\1'PL\1@d\1Hf=}f8\1@[N\1JffPP}9=g5ppR} WURjà \1X0=g=X0jU Rh`0KjS\1'PK\1Hf=f8\1@d\1@[N\1JffP19l~EEu}9 huU RhP_,uC9lj} WUR2\1 u15\1' u}WUP\1'P蒛_ =lBllkUhD$\1X0X0ց(h~19l~$h19t$st$],C9lEU R)hP_h}| D$(h5\1A\1e[^_]ÐUWVSDž}uE PMQÃOEPDžtM0҉R輔_SPA#_>à u19hE PMQhPM QEP|1hQE PMQEhQE PMQÃt"dSE P<_M QPS!jM QSQÃtrtCSY{SYu$Dž`1AI19~'P-_B9ۉ`B9s19~&Q_B9ۃu 1 `1[^_]ÐUjU RURNu1]ÐUS] hSMQd2 u16jSd2'PwPd21҅tƒ'Ћ]]ÐUWVSj_Eh2ujh0ۋ}щMQ踑_E h2B h2Myu }щMQh)} щMQZ_E h2 h2M9u } щMQhuVh2pV腖_E P54h2Pl_e[^_]ÐUVS195~Mh2;t7xt @P讌_8t P蜌_R葌_F95e[^]ÐU塜]ÐUEh2]ÐUWVS} 195~9h2W@P|_uF951e[^_]ÐUS]9u\LSt*1ې…tB'PBPlC␐؋]]ÐUS] Uȋh̋S_8u Sh΋]]ÐU8R]_]ÐUSMU =u$y},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},}},},},},},},},},},},},},},},},},},},},},},}},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},}},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},},}}}}}}}}}}}}}}}},},},}}}}R#f3f33ȋ]]UWVS}u Džfflfv f>thjrhWh`^==~=F f8}t~h5UR讋_RSR0}ЃEP[ 뵐e[^_]ÐUVS]u 3f;t0f;t)f;Jt#f;th7hhh=t= JtVt=t)=ubh3CP'nh3[SMSPh3Ê_ *ShǍۍZuh316u h3h3t33e[^]ÐUW}4ff fv"f?Jth܍h?h,h5ڙ=tJt =u4bG+WhS4>P:Ph4蓉_04ƀ44}]ÐUVSufffvhfh[hhHtIuV RÃ"VhώS*PSe[^]ÐUVSUu :@t]:#tX:&tS:|tNEPEPR\à }u؎IuЎPh5_Sh5Q_!VEPRQPh5N_5e[^]ÐU WVSMfffvhhhh|6MHtIu4A PMI Qƃ#EPh:ePMf9IuJRhWh|6 _0|6{6E] >t7EPVEuPS=_0҉ЃÃ>uʻ|6=|6;\uc{t{\tGS `Pu8KQj\h\h|6f_EPh|6臱NCA `Pu&Rhoh|6_MQh|6d7C;ZEPMQEt9Ef8IuRhh|6蹅_MQh|6ڰhh|6_|6e[^_]ÐUWVSUB$\|̉ ,<L\l̈\RR6"01ۃtE 3 uƂ6\BƂ6n6BC0щȃ9rƂ6"Ƃ6QE PR6EE3R Rh jRPhrr hh6σ_ďΏ֏ۏ~qaQARRGPhPhh6_6e[^_]ÐUh7UR臍7]ÐUVS]1C9CwSu_tCCxtF͐e[^]ÐUVSu1ۍEPhVty_ 9]v:F9FwVu_tFFxC9]wƃxe[^]ÐUjf]ÐUWVS5(f=4uE f80ffffHf#hff94vf4f49~hP賆(P,4)׉P0$Pe[^_]ÐUSf],90w5E6,ffBЋ]]UUfE 1Ʌtf9r%ff9EPȉȉ]ÐU,90w8,ffBMJЉ]ÐU,90wz:,ffBMJЉ]ÐU,90w:<,ffBMJЉ]ÐU,90w>,ffBMJM JMJ Љ]ÐU,90w@,ffBMJM JMJ MJMJMJM JM$J M(J$M,J(M0J,Љ]ÐU,90w*B,ffBMJЉ]ÐU,90wD,ffBMJЉ]ÐU,90wF,ffBMJM JЉ]ÐU,90wZH,f fBMJЉ]ÐU,90wJ,f fBMJЉ]ÐU,90wL,f fBMJM JMJ Љ]ÐU,90wN,f fBMJЉ]ÐU,90wJP,f fBMJЉ]ÐU,90w R,ffBMJM JMJ Љ]ÐU,90wT,ffBMJЉ]ÐU,90wzV,ffBMJM JMJ Љ]ÐU,90w*X,ffBMJM JЉ]ÐU,90wZ,ffBMJЉ]ÐU,90w\,ffBMJЉ]ÐU,90wZ^,ffBMJM JЉ]ÐU,90w `,ffBMJM JЉ]ÐU,90wb,ffBMJM JЉ]ÐU,90wjd,ffBMJЉ]ÐU,90w*f,ffBMJЉ]ÐU,90wh,ffBMJM JMJ Љ]ÐU,90wj,ffBMJM JMJ Љ]ÐU,90wJl,ffBMJЉ]ÐU,90w n,ffBMJЉ]ÐU,90wp,ffBMJЉ]ÐU,90wr,ffBMJM JЉ]ÐU,90w:t,ffBMJЉ]ÐU,90wv,f fBMJЉ]ÐU,90wx,f!fBMJM JMJ Љ]ÐU,90wjz,f"fBMJM JMJ Љ]ÐU,90w|,f#fBMJM JMJ MJMJЉ]ÐU,90w~,f$fBMJЉ]ÐU,90wz,f%fBMJЉ]ÐU,90w:,f&fBMJM JЉ]ÐU,90w,f'fBMJЉ]ÐU,90w,f(fBMJM JMJ MJMJMJM JЉ]U,90wJ,f)fBMJЉ]ÐU,90w ,f*fBMJЉ]ÐU,90w,f+fBMJM JЉ]ÐU,90wz,f,fBMJЉ]ÐU,90w:,f-fBMJЉ]ÐU,90w,f.fBMJM JЉ]ÐU,90w,f/fBMJЉ]ÐU,90wj,f0fBMJЉ]ÐU,90w*,f1fBMJM JMJ Љ]ÐU,90w,f2fBMJЉ]ÐU,90w,f3fBMJЉ]ÐU,90wZ,f4fBMJM JMJ Љ]ÐU,90w ,f5fBMJM JMJ Љ]ÐU,90w,f6fBMJЉ]ÐU,90wz,f7fBMJЉ]ÐU,90w:,f8fBMJM JMJ MJMJMJЉ]ÐU,90w,f9fBMJЉ]ÐU,90w,f:fBMJЉ]ÐU,90wZ,f;fBMJM JMJ Љ]ÐU,90w ,f<fBMJM JMJ Љ]ÐU,90w,f=fBMJЉ]ÐU,90wz,f>fBMJЉ]ÐU,90w:,f?fBMJM JMJ Љ]ÐU,90w,f@fBMJM JMJ Љ]ÐU,90w,fAfBMJЉ]ÐU,90wZ,fBfBMJЉ]ÐU,90w,fCfBMJM JMJ MJЉ]ÐU,90w,fDfBMJM JЉ]ÐU,90wz,fEfBMJM JMJ Љ]ÐU,90w*,fFfBMJM JMJ Љ]ÐU,90wĐ,fGfBMJM JЉ]ÐU,90wƐ,fHfBMJM JMJ Љ]ÐU,90w:Ȑ,fIfBMJM JMJ Љ]ÐU,90wʐ,fJfBMJM JЉ]ÐU,90w̐,fKfBMJЉ]ÐU,90wZΐ,fLfBMJЉ]ÐU,90wА,fMfBMJM JMJ Љ]ÐU,90wҐ,fNfBMJM JMJ Љ]ÐU,90wzԐ,fOfBMJЉ]ÐU,90w:֐,fPfBMJЉ]ÐU,90wؐ,fQfBMJЉ]ÐU,90wڐ,fRfBMJM JMJ Љ]ÐU,90wjܐ,fSfBMJЉ]ÐU,90w*ސ,fTfBMJЉ]ÐU,90w,fUfBMJM JЉ]ÐU,90w,fVfBMJЉ]ÐU,90wZ,fWfBMJЉ]ÐU,90w,fXfBMJM JMJ Љ]ÐU,90w,fYfBMJЉ]ÐU,90w,fZfBMJЉ]ÐU,90wJ,f[fBMJЉ]ÐU,90w ,f\fBMJЉ]ÐU,90w,f]fBMJM JЉ]ÐU,90wz,f^fBMJM JЉ]ÐU,90w*,f_fBMJM JMJ Љ]ÐU,90w,f`fBMJЉ]ÐU,90w,fafBMJM JMJ Љ]ÐU,90wJ,fbfBMJЉ]ÐU,90w ,fcfBMJЉ]ÐU,90w,fdfBMJM JЉ]ÐU,90wz,fefBMJЉ]ÐU,90w:,fffBMJЉ]ÐU,90w,fgfBMJM JMJ Љ]ÐU,90w,fhfBMJM JMJ Љ]ÐU,90wZ,fifBMJЉ]ÐU,90w ,fjfBMJЉ]ÐU,90w ,fkfBMJM JЉ]ÐU,90w,flfBMJЉ]ÐU,90wJ,fmfBMJЉ]ÐU,90w ,fnfBMJM JMJ Љ]ÐU,90w,fofBMJЉ]ÐU,90wz,fpfBMJЉ]ÐU,90w:,fqfBMJM JMJ Љ]ÐU,90w,frfBMJM JMJ Љ]ÐU,90w,fsfBMJЉ]ÐU,90wZ,ftfBMJЉ]ÐU,90w ,fufBMJM JMJ Љ]ÐU,90w",fvfBMJЉ]ÐU,90w$,fwfBMJЉ]ÐU,90wJ&,fxfBMJM JMJ Љ]ÐU,90w(,fyfBMJЉ]ÐU,90w*,fzfBMJЉ]ÐU,90wz,,f{fBMJM JMJ Љ]ÐU,90w*.,f|fBMJЉ]ÐU,90w0,f}fBMJM JMJ Љ]ÐU,90w2,f~fBMJM JЉ]ÐU,90wJ4,ffBMJM JЉ]ÐU,90w6,ffBMJЉ]ÐU,90w8,ffBMJЉ]ÐU,90wz:,ffBMJM JMJ MJЉ]ÐU,90w*<,ffBMJM JЉ]ÐU,90w>,ffBMJM JMJ Љ]ÐU,90w@,ffBMJM JMJ Љ]ÐU,90w:B,ffBMJM JMJ Љ]ÐU,90wD,ffBMJM JMJ MJЉ]ÐU,90wF,ffBMJM JMJ MJMJЉ]ÐU,90w:H,ffBMJM JЉ]ÐU,90wJ,ffBMJM JMJ Љ]ÐU,90wL,ffBMJЉ]ÐU,90wZN,ffBMJЉ]ÐU,90wP,ffBMJЉ]ÐU,90wR,ffBMJM JMJ Љ]ÐU,90wT,ffBMJЉ]ÐU,90wJV,ffBMJЉ]ÐU,90w X,ffBMJM JMJ Љ]ÐU,90wZ,ffBMJЉ]ÐU,90wz\,ffBMJЉ]ÐU,90w:^,ffBMJM JMJ Љ]ÐU,90w`,ffBMJM JMJ Љ]ÐU,90wb,ffBMJM JЉ]ÐU,90wJd,ffBMJM JЉ]ÐU,90wf,ffBMJM JЉ]ÐU,90wh,ffBMJЉ]ÐU,90wjj,ffBMJЉ]ÐU,90w*l,ffBMJM JЉ]ÐU,90wn,ffBMJЉ]ÐU,90wp,ffBMJЉ]ÐU,90wZr,ffBMJM JMJ Љ]ÐU,90w t,ffBMJЉ]ÐU,90wv,ffBMJM JЉ]ÐU,90wzx,ffBMJM JЉ]ÐU,90w*z,ffBMJЉ]ÐU,90w|,ffBMJM JЉ]ÐU,90w~,ffBMJM JЉ]ÐU,90wJ,ffBMJЉ]ÐU,90w ,ffBMJЉ]ÐU,90w,ffBMJM JMJ Љ]ÐU,90wz,ffBMJЉ]ÐU,90w:,ffBMJЉ]ÐU,90w,ffBMJM JMJ Љ]ÐU,90w,ffBMJЉ]ÐU,90wj,ffBMJЉ]ÐU,90w*,ffBMJM JMJ Љ]ÐU,90w,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90wZ,ffBMJM JMJ Љ]ÐU,90w ,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90w,ffBMJM JMJ Љ]ÐU,90w:,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90w,ffBMJM JЉ]ÐU,90wj,ffBMJЉ]ÐU,90w*,ffBMJЉ]ÐU,90w,ffBMJM JMJ Љ]ÐU,90w,ffBMJЉ]ÐU,90wZ,ffBMJM JЉ]ÐU,90w ,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90w,ffBMJM JЉ]ÐU,90w:,ffBMJM JЉ]ÐU,90w,ffBMJM JMJ Љ]ÐU,90w,ffBMJM JMJ MJЉ]ÐU,90wJ,ffBMJM JMJ Љ]ÐU,90w,ffBMJM JЉ]ÐU,90w,ffBMJM JЉ]ÐU,90wZ,ffBMJM JЉ]ÐU,90w ‘,ffBMJM JЉ]ÐU,90wđ,ffBMJЉ]ÐU,90wzƑ,ffBMJЉ]ÐU,90w:ȑ,ffBMJЉ]ÐU,90wʑ,ffBMJЉ]ÐU,90w̑,ffBMJЉ]ÐU,90wzΑ,ffBMJM JЉ]ÐU,90w*Б,ffBMJЉ]ÐU,90wґ,ffBMJЉ]ÐU,90wԑ,ffBMJЉ]ÐU,90wj֑,ffBMJЉ]ÐU,90w*ؑ,ffBMJЉ]ÐU,90wڑ,ffBMJЉ]ÐU,90wܑ,ffBMJЉ]ÐU,90wjޑ,ffBMJЉ]ÐU,90w*,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90wj,ffBMJЉ]ÐU,90w*,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90wj,ffBMJЉ]ÐU,90w*,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90w,ffBMJЉ]ÐU,90wj,ffBMJЉ]ÐU,90w*,ffBMJЉ]ÐU,90w,ffBMJM JMJ Љ]ÐU,90w蚿,ffBMJM JMJ Љ]ÐU,90wJ,ffBMJЉ]ÐU,90w ,ffBMJЉ]ÐU,90wʾ,ffBMJM JЉ]ÐU,90wz,ffBMJЉ]ÐU,90w:,ffBMJЉ]ÐU,90w,ffBMJM JMJ Љ]ÐUS,90w詽 ,ffB]ZM JM]J ZЋ]]ÐU,90wJ ,ffBMJЉ]ÐU,90w ,ffBMJЉ]ÐU,90wʼ,ffBMJЉ]ÐU,90w芼,ffBMJЉ]ÐU,90wJ,ffBMJЉ]ÐU,90w ,ffBMJЉ]ÐU,90wʻ,ffBMJЉ]ÐU,90w芻,ffBMJЉ]ÐU,90wJ,ffBMJM JЉ]ÐU,90w,ffBMJM JЉ]ÐU,90w誺 ,ffBMJЉ]ÐU,90wj",ffBMJЉ]ÐU,90w*$,ffBMJЉ]ÐU,90w&,ffBMJЉ]ÐU,90w誹(,ffBMJЉ]ÐUSf] ,90we*,ffBMJfZЋ]]ÐU,90w,,ffBMJЉ]ÐU,90wڸ.,ffBMJЉ]ÐU,90w蚸0,ffBMJM JЉ]ÐUS]0fCf{!H=$h(hhhXXXXhhXhhXXXhhhhhhh8XhhXhhhhhXhXXhhXhhXhhhhhhhXX8Xhhh8XhhhhhXXXX(XXXXhhhhhXhXXXh8hXXXXhh[0SRS RSRSRSRSRS RS$R S(R[,SRS RSRSRSR[SRwS RnSReSR\[YSRGS R>SR5[ 2[ SRS R[[SR[ ]]ÐUS]99|(P9u %J@99}999LujhLhP=9P9]]ÐU 9RU RjUR+_]ÐUSSEPAShV 9R#+_]ÐUS]u4 9P9Pwh''f{uY 9P9PwhP&_@Sf9jh9c'f{vY 9P9PwhPY&_@SDf9jh9jS|f;vI 9P9PwhP%_@jSb4 9B9BwPR%_ BfCH=j&$(Hh(H(Hh(Hh(Hh(Hh(Hh(Hh8Xx8Xx8x8Xx8Xx8Xx8Xx8Xx8Xx8Xxh(Hh(HhHh(Hh(Hh(Hh(Hh(HxXx8Xx8XxHh8x8Xx8Xx[`CPCPhZ!CPCPhc!CPCPhlCPCPhu 9Q$_KQK QKQKQ KQKQK QK$QK(Q[,~CPCPh~ CPCPh CPCPh 9Q%$_hx[S7hxh 9Q$_ 9P9P CPCPh; CPCPh CPCPh+CPCPhCPCPhCPCPhɣCPCPhң{CPCPhۣCPCPhCPCPhCPCPhCPCPh;CPCPhCPCPhCPCPh{CPCPh#[CPCPh,kCPCPh5KCPCPh>CPCPhGCPCPhPCPCPhYCPCPhb{CPCPhk[CPCPhtkCPCPh}KCPCPh+ CPCPhCPCPhCPCPhCPCPh{CPCPh 9Q_KQK QKQKQ KQ[CPCPhCPCPhŤCPCPhΤCPCPhפCPCPh{CPCPhCPCPh;CPCPhCPCPh+CPCPh CPCPhCPCPhCPCPh(CPCPh1[CPCPh:;CPCPhC 9Q_KQK QKQzKQq[ nCPCPhLCPCPhUCPCPh^CPCPhgCPCPhpKCPCPhy+CPCPh;CPCPhCPCPhCPCPhCPCPh+CPCPhCPCPh{CPCPh[CPCPhʥkCPCPhӥCPCPhܥCPCPh 9Q5_hx[S.hxh CPCPhkCPCPhKCPCPh[CPCPh ;CPCPhCPCPhCPCPh'CPCPh0CPCPh9kCPCPhBKCPCPhKCPCPhT CPCPh]CPCPhfCPCPhoCPCPhxCPCPhkCPCPhKCPCPh CPCPhk CPCPhCPCPhCPCPhCPCPhCPCPhɦkCPCPhҦ CPCPhۦ+CPCPh CPCPhCPCPhCPCPhCPCPhCPCPh CPCPhKCPCPh#+CPCPh,;CPCPh5CPCPh>CPCPhGCPCPhPCPCPhYkCPCPhbKCPCPhk[CPCPht CPCPh}CPCPh CPCPhCPCPhCPCPh CPCPhKCPCPh[ CPCPhk CPCPhŧK CPCPhΧCPCPhקCPCPh+CPCPhCPCPh{ CPCPh[ CPCPh; CPCPh CPCPh 9QU_KQCPCPh;CPCPhD 9Q% _[CPCPhMkCPCPhVKCPCPh_+CPCPhh CPCPhqCPCPhz 9QU _hx[Shxh+CPCPhCPCPhkCPCPhKCPCPh+CPCPh CPCPhCPCPhCPCPhŪCPCPhΪCPCPhתkCPCPhKCPCPh+CPCPh CPCPhCPCPhCPCPh CPCPhCPCPhkCPCPh(KCPCPh1+CPCPh: CPCPhCCPCPhL 9QU_KQ<[ 9CPCPhUCPCPh^{CPCPhg 9Q_hx[ShxhpCPCPhsCPCPh|CPCPh 9Qe_jCPj.CPCPh 9Q5_jCPjC PCPCPhkCPCPhKCPCPh+CPCPh CPCPhCPCPhīCPCPhͫCPCPh֫CPCPh߫ 9Q_hx[ShxhCPCPh 9Q_hx[SshxhCPCPhCPCPhCPCPh CPCPhCPCPhnCPCPh$ 9Q_CP{CPCPh-CPCPh6 9Q_iCPCPh? 9Qe_hx[S#hxhH 9QA_ 9P9PwjP4_@]]ÐUS] E 9fTf=Tu 9SSf T]]ÐU 9RU RjUR_]ÐUWVSuShK 9R_0ЃPSf[^_]ÐUWVS] 9B9BwR_t 9Pf@ f9==t-=tY=t"&jh99P]&jh9jh99PPSf99tYh `hQ8_ Ѓ>jh9D9PLj 9P賈9H=%$8 ( H h      ( H h      ( H h      ( H h      x     8Xx8X8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx(Hh(Hh(Hh(Hh(Hh(Hh ( H h     !H!h!!!!!"8"X"x"""""#8#X#x#####$8$X$x$$$$$%8%X%x%%%%&8&X&&&&'('H'h'''''(((H(h((((()PPhi!PPhs PPh}[PPh5 9Vc_P PPP PP P$P(P,PPh+ PPh PPh PPhPPhPPhì PPhͬkPPh׬KPPhPPh PPhkPPhPPh PPhPPh;PPh'PPh1PPh; PPhEPPhOKPPhY+PPhcPPhmkPPhwKPPhPPh PPhPPhKPPh+PPh+ PPhkPPhǭKPPhѭPPhۭ PPh5 9V_P P PP PPPh{PPh[PPh PPh PPhPPh!PPh+PPh5PPh?PPhI[PPhS;PPh]PPhg{PPhqPPh{PPh5 9VC_P PPP PPh;PPhPPh{PPh[PPhPPhPPhˮPPhծPPh߮;PPhPPh PPhPPh;PPhPPhKPPh%PPh/PPh9;PPhCPPhMPPhW;PPhaPPhk{PPhu[PPh;PPhPPhPPhPPhPPhPPh{PPhůPPhϯ;PPhٯPPhPPhPPh PPhk PPh PPh[PPhPPh)PPh3PPh= PPhGPPhQPPh[PPhePPho;PPhyPPh PPhPPhPPhPPh{PPh[PPhPPhɰPPhӰPPhݰPPh;PPhPPh{PPh PPh;PPhPPh#{ PPh-PPh7; PPhAk PPhKK PPhU[PPh_;PPhi+PPhsPPh}[ PPh; PPh PPhPPh5 9V_P P}PrqPPhPPhk PPhñPPhͱPPhױPPh PPhKPPh+PPh PPh  PPh PPh+ PPh' PPh1;PPh;PPhEPPhO PPhY PPhcPPhm PPhw PPh5 9V_jP PPh+ PPhPPhPPh PPh{PPh[PPhDzk PPhѲK PPh۲PPh PPh PPhKPPh PPh  PPhPPh!K PPh++ PPh5PPh? PPhI PPhS+PPh] PPhgk PPhqPPh{+ PPh PPhkPPhPPh{PPhPPhkPPhPPh˳PPhճPPh߳5 9V_P P  PPh+PPh^PPh>PPhPPh5 9V_bPPhPPh%PPh/PPh9PPhC{PPhM{PPhW;PPhaPPhkPPhuPPhPPhPPh{PPh[PPh;PPhPPhPPhŴPPhϴPPhٴPPh{PPh[PPh;PPhPPh PPhPPhPPh)PPh35 9V#_P PPh=;PPhGPPhQPPh[PPhePPho5 9VC_jPFj.PPhy5 9V_jPj P PPh+PPh PPhPPhPPhPPhPPhkPPhɵKPPhӵKPPhݵ+PPhPPhPPhPPhPPhnPPh5 9V_PPPh#PPh-5 9V_PPPh75 9V_5 9Va0xЃPhxBe[^_]ÐUU 9fTf=Tu 9EPf TE]ÐUS] H= $)-666-66666666666.66./(/6666666H/6666h/66/6/66066066666666606666666666x11661666666666666626666666(2H266666h266666626666666666666666662266283666X33466666666666684X4x466466664464566666666666666666856666X566x556566(6H6h666666666666666666666666666666S9C S9C9RS 9C 9RS9C9RS9C9RS9C9RS9C9RxS 9C 9R\S$9C$9R@S(9C( 9R!S,9C,S9CS9CS9CS9CwS9CWS9C9RDS 9C 9R(S9C9R S9CS9CS9C9RS 9C 9RS9C9R|S9C9R`S9C9RDS9CS9CS9CS9C9RS 9C 9RS9C9RS9C9RpS9CGS9C9R4S 9C 9RS9CS9CS9CS9CS9CwS9CWS9C7S9CS9CS9CS9C9RS 9C 9RS9CS9CgS9C9RTS 9C 9R8S9CS9C9RS 9C 9RS9C9RS9CS9CS9CgS9CGS9C'S9CS9CS9CS9CS9CS9CgS9CGS9C'S9CS9C9RS 9C 9RS9CS9CS9CzS9CZS9C:S9C9R$S 9C 9RfK]]ÐUS]ScS]]ÐU]ÐU]ÐUWS]=DthLjShZhe1} tHP裓}tc0ЃP)_j/ShW1_jW_t"Whh `_W_S葊D}%ShzDhxQhƶP@YR܆>]jEPh@YRΆu'R@YR$2| 1]]ÐUS]=uhB@YROBjdCPP ~SPPu&Qu : SP@YR蹊u]]ÐUSSu Cu]]ÐUWVS}u h Glt]ÐjLYRRmu 1]Ðu ]Ð]ÐUhWjLYRn|W]Ð1]ÐUhWjLYRJp tPheh `K_]ÐUWVSu>hhhh^uh׻hhhf0uhhh>hI9N NjShNb Q{t3}]t M 9H$t& M N$VR LYQ'ou1e[^_]ÐUS]SUUjEPhgjEPhpLYR juSLYRe]]ÐUS] UUjEPhyLYRiumjLYRju]hWjLYRl uBSXR!uhWjLYRn thh `_]]ÐUEtXtXEjEPhTYRht]ÐjTYRju 1]Ðu ]Ð]ÐUhtXjTYRk|tX]Ð1]ÐUSE]tX@HxXjU Rh|X_jShX_htX]]ÐUS]=uhN TYQgNjCPP_ Pt}At SR TYQClu1]]ÐUU UUUjEPhjEPhTYR,gt1]ÐhtfFQV_~af^P,_‰u)FPhh `_fF9FPM QR)_fFe[^]ÐUWVS}1G(9p~91ېU R@DP_uG(@DFG(9p̸e[^_]ÐUU RURh諓_]ÐUE 9E%]ÐUWVSUE M]u8%%e[^_]ÐUEPEPEPEPURE@%PURURUR&]ÐUEU Љ]ÐUEU ЋUE]UEPEPEPEPURURURURURhhY&_Y]ÐUEPEPEPEPhUR_URURURURW]ÐUh_h _jjjjjh(_]ÐUhO_jjjjjhsӑ_]ÐUSEU M]]]ÐU4WVSU} 0Љƃ~ttRhRhP_ =u#Phh `莋_ hSb_ktC;uE PShPl_19u ~+PhS_ tF9u 9u 0ЉƃVRS-_ t(: u CECB:uh `S蝊_01t CF0щȃ9r1UJ9} .CF9|h `P7_hh ` _P^_[^_]ÐUh `w_hh `Љ_MQM QMQUE8tRPh `u_hh `薉_jP]ÐUh `_hh ``_URU RUR3EPURh ` _$h `h;_9}j]ÐUh `臈_hh `_U E 8tRPh `薔_hh `跈_jq]ÐUh `'_hh `耈_hh `q_U E8tRPh `'_hh `H_j]ÐUh `跇_hh `_E PURh `Γ_h `h_ 9}j]ÐU SE],tPh"EPԐ_ EPU(RU$RU RURURU REPURh&URf_,9}j ]]ÐUS]|hAh `!_Sc_UWVS]0PSV|_e[^_]ÐUUBu 1]Ð: t: uЉ]UU 8 t8 t]ÐUWU:t0D}]ÐUWS]0Ѓxڐ: t: uJHy|tDe[_]ÐUWS]0ЃU ) CJe[_]ÐUE€8t:/uBB:u]ÐUWU0Ѓ9v8.u H9w}]ÐUS];tN9t `t#9t `C;u]]ÐUS];tN9t  `t#9t `C;u]]ÐUEuhXh `?__PR_]ÐUWVSu] 0P_uPS6V臍_e[^_]ÐUSURۇ_Ãu؋]]ÐUhl_j܂_UWVS]u hj_u"hY_uhH_tu0҉ЍDP_ǃ;tVShW_VhW_ WS_e[^_]ÐUWS]0Ѓx</ttڐJHx:/tuu ;/tt}1SPPhhLZ荋_LZe[_]ÐUWU0Ѓx </tHyDPhhL^C_L^}]ÐUWVS]u }tVWShh `_5=pge[^_]ÐUE)]ÐUWVSE=t*1DŽ=~11҃t:@~u9jhhE͐huV]]+]P9ǃ0}ҋ=P蠄_t'5Vj/uVhGP蓉_E#hlh&h<~BlP%CÃWSaAVSAV<W<ߋltttUz4t J4Q<lJWBMA4t]W<UB8B4ehlhh"Dhlh.hY|$hlheh\W<L[^_]ÐUWVS]S8C49C@t9{@uhqhhhqhh@PK$QFu>hqhhK$  {@tK@QC$P&뫐1C(9x1@UT0|0uORWSgPC(@PSu{@YK@QC$P&&C@>|0uIRWSPC(@PSqu){@K@QC$P%C@GC(9x@{@tK@QC$P%C@1e[^_]ÐUWVSu~4tF48&jhh3uM yu'0}ЉÃU Z M Q/]EPSURM QPÃu1hohBhVU R] u+hohehyM Q\URF$P#uM Q\}WjEPjURN$QIÃu,hjhhHV$MQ}U zu0}ЉÃ M Y SURM Q^LËURF$P#tuhqhhMQV$RChrhhaE@PN>EWE@PMQjURN$QHÃu-hkh h*9V$MQF4V8PMQ5>Eu#hsh9hVoM@PV$R?ǃuhkheh&MQV$RBu;hrhhN$ URF$PO"MQF$P1"U@PRjWN$Q&IÃt1hkhhv$5?jWURM QVÃuUR6MQ61؍e[^_]ÐUWVSuU ]zu0Ѓ B PSRI tu&hqhh bv$51e[^_]ÐUWVSjjMQuVÃ} 9^jQUR.} 0щ}щR+ËEPU RhBS-c_ Pj/)RhHVb_j0щʃRSj h@jEPj}tMQjVjNǃDS2+ujhOhp>WB>h|R'Y_ǃ u*hghh/PURE PhWX_WLX_[^_]ÐUxWVS QE PMQ^ ujhhPj/ME)͐PhSa_MQj@Sv9 u5hghh1E @ 19p1ېM I|t_E P ׅ}$)tM A )ЉA M QD<v| u!؋M APOM QD E @M I LE @D M A F9qgM Q Ӆ}$)tE H )щH hP#1AE @ PM IQE Ph*]S*`_Dž0҉ЃPSjIQP:‰0։10M 9q1ېE PL QDPLQTRh4P__0҉ЃPQPIQP9‹0у,FuE 9pathkhAhdAjPjIQP9ƒt6hkhph PhME)͔P&U_à u9hghh pgQhhP QE PhST_S7T_1M 9q~S1ۋE P|t8MQ|QDPTRM QEPƒgFM 9qEE+EŐP 1|[^_]UWVSj%dbjjPX_j%dbEP$Zu2hkh h$ bQ1uVjEPjSR5NjUUu*hjh1hSbP{fR$tVEPtQjSE@$P5ǃu?hjh`h}+ bQtP$MI$ 1tp1ۀ8 tCp< tOvCPu4hkhhbPtQuSpPVV_ D+0҉҃pb P bQbPhV[_ǃup b QEP[_duQbz}qChkhhhjhh' bQtPx#1Rd RP #dbBRd RP"dbBEDžxx9JlEh11ۋp9 tCp< tOvCPSpQlP8U_ D+l0҃p|PMQEPhQhlPY_ǃh0҉dR!db`PdL2h0҉dRhP`ID1P bIED1 bIED1b|KD1 K|1tPUׅ}$)t E)ЉESD2<v|2 uCP? bRD2 bMBL0|Exx9J25bEF UӅ}$)t F )ЉF tQ bT[^_]ÐUWVS}u]?t R t919w~#1ېG|t DPp F9wWR[ WU 1e[^_]ÐUSEtÐ؋[4t P% u1]]ÐU,WVSUh4)ЋŔPN_ƃu 1MQM Qh6]S.W_SÁ}ԐWh<VN_Wh@VN_u9]uۃt#t9]uCVT_uVL_ShLhbV_be[^_]ÐUWVSUr 1E9 ~\1ېPURV_u'PU RV_u x>?Eu U9 e[^_]ÐUSM19t1A9u%]]ÐUWS0҉߈tSPhQh `xL_e[_]ÐUWVSUj)Ѝ4PEurPW_0щMQËVSU_0щȃڃJ9v:/uSQW_SK_Ee[^_]ÐUEM Q)‹ՔR ]ÐUWVShoURJK_uhghqh0ۋ}щQ}щʃRwEPRT_}щʃBffBURPET_щT hP\J_ u+hghhGRhVI_ 0щƄ t t C;t; u{{t{ tG?t? uG} tRU RV,S_t; 0щƄ RV{I_/WPR_RT_ PH_URT_jjPH_PRRLH_EPRL_ PUT_RH_PH_1[^_]ÐU WVS1h}WbH_u!hghhMQhSG_ tF䐐}tQ)Pg}QN_1ېQڋ}BPRhQG_Wj/MQh>PP_(?)9} tWF_M 1[^_]ÐUWVSuU 0Ѓ]9~SRVP_3e[^_]ÐUS]1{tFjjRJ_ t-jCPRcS_ %tSr"]]ÐUUB< t<t< u ]ÐB ]ÐUWVSU}EtR1ۋMA(pRT tt u ] \EMA(M9H1PD2< <t< w] \2tKL2CEt Ct {t;t QC{ CP] \2tKL2CEt fCt#f{t;t QIfCf{CPs] \2t KL2KMt Ct#{t;t QCt{tKQeEMA(M9H@Ee[^_]ÐUVSu] jjjSV{Lt`tWt%=4uhH_ 4jnL_t=8t8됐e[^]ÐUjU RURL]ÐUEPbbb]UEPbPbPbbb]ÐUh< jA_UWVS]u }tVWSh~h `nB_(5 =,e[^_]ÐUUR]UVS, (=0u 0UR. Ãu 0и|uiSSB}&jhhu%hFB_t e[^]ÐUS], (S-]]ÐUWVS}u ], (SVW ujhh.t CPjhh01e[^_]ÐUS] , ({Pt SPRiURSUR | #jhh0и]]ÐUEU R@TPu1]Ðjhh4]ÐUUR]UjjU RUR]ÐUWVSE1, E(EFFu MMy,tQ,RMA,VU~NM]j8NB_Ãu-URhlhGhQ0иfjMQSC US$K({,C0C4 }tUZ4}u]}TUMQ,1e[^_]ÐUWVSu} , ](]^^u~4mF48a\GF,x4thhh_hq)V:hu-jhzh,0и uPhRV*à t~,t*UVu0иi\~4tF48Et @F8 F8tv4Vh1e[^_]ÐUWVS}u , (s=FwH uPhRW;à tiURVWWà u!20uW!4tG48 VURVW tttjhh0Љ؍e[^_]ÐUWVS}u ], ( u SjWnSVWdà ؍e[^_]ÐUE]ÐUE]ÐUS]S@RC$P6C@]]ÐUE@@]ÐUWSh `8_E PEPh `D_hh `9_ 0ۉ׈tR,Phh `8_=tzhh `8_PpgPhh `8_=thP=< `t(< `9B`|@`Rhh `D8_ De[_]ÐUWSh `7_E PEPh `C_h3h `7_0ۋ= t3(P,Ph5h `7_ PhXh `7_=t3PpgPh]h `x7_Ph}h `c7_=thP=< `t(< `9B`|@`Rhh `7_ e[_]ÐU, (]ÐUWVSE0}Ѓ]K9]s;/u9]t`hj<7_EujhhCUR3_uC/jhh9hj6_ƃujh"hH 0҉P9_ǃu1hlhUh_01SVhlW>_jWC2_t$jhrhjW2_tjhhFjW1_tjhh&}t*UR2_ujhh819]tC/e[^_]ÐUWVS}1ۋG(9X~91@D0PW,R>_uCG(9X̸e[^_]ÐUWVS}G(p EM9HEP}D:<v|: uzMD < tB<tg< tLW] }\:C;] M\ C] }\:sEEMA(}9xVMyPt yPWVMAPEA(@ P} WMQ7_ }G(H ME}9x1PD2<v |2 D2< tX<t"< tl] \2CP Q}W7_ C.] \2CP Q}W6_ Clj}*] \2KQ;WMQ6_ []E}G(M9H e[^_]ÐUWVSEMA(M9H~a1PD2<v|2 u7D2< t<t'< u] \2;t ShEMA(M9HMqPA(@ PVM Q5_ MA(p EM9H1PD:<v |: D:< th<t"< ] \:{CPuSRVP?5_ C;] \:f{tbCP8SRVP5_ CƃB] \:{t#KQKQVP4_ sEMA(M9He[^_]ÐU WVSUB(JPH MEU9PnEpMD<v | 1UD< tv<t < ] M\UBPD@8Ct3}KCE] M\UBPDf@f9Cft3}KupCEp] M\UBPD@9CuKt3}u9[]:MA(@qPUt} |D t EEUB(M9H1e[^_]ÐUUR2_uhh `f._j-_]ÐUEP\._]UVSu]CPU RV7_3e[^]ÐUVS]u{t;t RtSVPVU RP2_ Ce[^]ÐUVS]uf{t;t RAtfsVVU RP1_ fCe[^]ÐUVS]u{t;t RtsVVU RP]1_Ce[^]ÐUh@j5_dgh`j5_`P]ÐUdgRjo5_=tj4._P0_`RjE5_=Pt j ._P/_]ÐU]ÐUP]ÐUWVS}} M9U :M9U :MM Pƃu 1EU 9:|VUM9|0MUMU9u MMGECU9}܃EEUM 9}t"O>VVE+_"V.+_je[^_]ÐUWVS}} MM PEMQMQM9M 91|dMM M1ҋM9~&MM MM9u@u9E}~M MMGEFM 91}t%OM9QËMQ2*_MQ*_1e[^_]ÐUU @PRMQ._]ÐUWVS]u ;LV>PRQ-_63e[^_]ÐU WVSuEEE} 9|Y}<}9|F9tVA9| 9u9};E8EEEEE} 9}e[^_]ÐUWVSU} uRhQ._e*?u)PQRh,.._9|.wQG~EPhH-_ C9}hM-_e[^_]ÐUVSuR ÃtVS`؍e[^]ÐUWVS}4V.,_ÃuWhP-_ VjS[,_؍e[^_]ÐUWVSuU 9|9VtFC9|9u9}1fHPgE9}MV:9@9|C9| }9:C9}6N}7Ee[^_]ÐUVSMu ]9|!A9u0B9}e[^]ÐU WVSMyQRhD,_EEPMI QUR$RMQURRMQEtO}UUMq$19}%>tRNQSh+_C9|ރ}t$h+_e[^_]ÐU4WVS}EE} .WhE} }EPO QO$QMQOQWẼ3}u_$u_$u19M 9K|u M؋C+E = v"E E܋E 0K)MM EEKMjEPMЍPOQWVEB9wMMЃ}u }W}unOM؋GE GM MEEEEW t-!WFSW6CER"EEEEEPMQWuEE؍e[^_]ÐUVS]R!_{$t S$R#_S#_e[^]ÐUEU uSt:u* LQ TQh `#_]Ð LQR `Qh `[#_]Ðxu=< `tR(_]Ðt:u@P뇐@P뚐UDWVS}] EPSW 9_uGM}~EPSW}u}t*SWuEPSW p]ȋMM̃hW@GCWtOQW&G$G$@jO$QjOQWWWZEPOQW E9Ev2jEPMQOQWrEPO QO$QVOQWEBu_$Eă_$E19}]u;uGjEPMQOQWWW1EB9|}uuNMɉMԋ_؃ȉGER"MMEEEEPSWZ tfSOQWw* tSjuVMQSW&t:OMȋMMjVMQSWt_WWWe[^_]ÐUWVSu] }u FJjSR#_ 9u.jWR%_tӃu!?R"u1Fe[^_]ÐUVS]=$u{u 11jjSRR(u$e[^]ÐUE=$tjPRP($]ÐUSj("_Ãh"_C$C MQE PMQ#_‰ |kjCPR$_ u)CR"CCCSu/{R"u&CC CSB_1]]ÐUVSu] jSR"_ 9ujURR*_tF1e[^]ÐUWVS}]uEEPU RW tq9E~E9E}u)ޅ~/jU \SRi!_ 9tG-VUR?W#_U92u E e[^_]ÐUPWVSu0EEPU RV UȉUtE}̃tÀ}tEPURV tEPURV tj}tỦUtUȉUEEEPU RVT t0tEPWV= t}tEPURV!u1e[^_]UWVS}uEPM QW t9u| E9E}Gt}~*jUM \SR_ 9tGVMQRK(_ 9uE9E}EEPM QWYt1e[^_]US]jjRM_ ujCPS'_t1]]ÐUWVS}W& E?tR_}E@t W@R_w8t^ VR_V_ރuW_Ee[^_]ÐUWVS}uG 9vG  GWVVU RW!uW]W$JUG@ЉEPWE ÃuW&SREPEPWRW(RVU RuWduG W>GU9W,upCx ug@C@SW uWzG$W u WQWJ!Cx U9W,tx xjW ƃuWtVRSRURSVCSWD tVW5 uW GW 1CUptPRWu ÃuWV CpSW uW. tKVW Ãu W xCUSWj uW SURW t-MG@UDEG@ЉEPW ÃWg e[^_]UWVS]} uC 9vC CS VWSr}S$C@TRS teHKC@PCPMQKQK(QVWuS 17tKS C S e[^_]UWVS1UB@J,UB@PRtǃt0MAD9u2ADADPQ@R_MA@u_{uGOUJ} uG@ BUBMA1X} t{ uFUB@[:FMI@CGP)‹C e[^_]ÐU,WVS] }G 9EvG}MA}W MQSWTuW}O$IMG@ȉEjWEu W`}}MA A Q )Ћ}GE܋MQS}W_ MM}GMQWxƃ~WEPEPMIQ}(WMQ}WuMA ^{}u}GVCFP)‹[ ‹EM V}W-tMQWu}W%MAQ-Fx @UM9Q jQQÃ{WNQ}WEPMQ}WgNKFV}W} t!SWntMQW\u}WfMAQm}W'EjWÃjWEԃEPMQ}ԋWKQ~WMA A P}WEPMQ}W>MԋA}8QF@BSFFE؋CMH}{}ԉOF(VMQZ>S}WD(MQW.}t<}WMQƃF}xVMQ}}}M9y,QEԃjMQ;ƃj}W#ÃvF@F@ F@FMH{WNQjEP}WMQF}ԉ{SMQ$ }WMQ V}WMԉO,G$GWGW>1M}G@MDEG@ȉEPWƃM}9Ot5}MA A Q )Ћ}GEVMA A Q )Ћ}GEOM!t V}W}tMQ}WMQ`e[^_]ÐUS]{tjjR_ ujCPR_t C1]]ÐUVSu^8tH;u;{t5jSRR_ 9CuV RSRRS_ 9F t [ u1e[^]ÐUSMU zu9Q8} 9QW_ 9Cű~ W{W>W_ 9F uSV]1e[^_]ÐUVS]u VSƒt5BK0B@RS)ts0CSDe[^]ÐUVS]{0us4S S4#S0RSfts0@C0CSte[^]ÐUEjjjjP]ÐUS]SjjS{]]U(WVSEEEEEEE;E1jH_Ã5CCU u"F$\ <zJMEJMEzJMlJMYJMLJM<JM܃JM#JMu JKrMQMQW1_ SjCP Q@_ƃMQ _ǃMKMK MK(C$MK,C0ɉK4CSluG GGGjMQ Q\ _ 9EuMQW Q_ 9Et1WW_M9KC$CDP _C@C81E}tMQMQSv }uaEXj _Eto{8uC8MqAA K Q _MAt9tN uM}uMK1Y]9]@u} 9G u'w]3(}}e[^_]ÐUWVSUEJ A}O M JO JOJOz}]BЍHM)Ƌ}GH)MR E ȉEEE}M9y M9Mu`}uZ1ҋ} 9}}M ECB9U }u M } }M OE} }M9M9M}u*1ҋM9~FM ECB931M ECB+F9|EM}}}}E}EM}9O e[^_]ÐUWVSEE} W J}W } }} W}W} W}W}] } GPU)EU9W }9}u8u19>~ CA91ɋ+F9}CA9|M_}u*1ɋU9~G}CG}A931}CG}A+F9|E}U 9z U}U 9z uztz)U z+}UzU BЍx})ƋUBЍx})ËU R } ؉EE}U 9z ~wU9Uu}}SU B H9Eu$zt}9z u9Uz#+U}}EU} 9W e[^_]ÐUWVSuM }y u]1Y]AȍP)‰Ѕu+\DE]99AȍP)‹I Ћ4]3?W]S]S5_1e[^_]ÐU(WVSEEEE}}] MAȍP)‹y ‰UM A}GP)EEG 1M9Mu8}u219U ~M ECB9U } }Eo}u*1ҋM9~M ECB9>}61M ECB+F9|+FEE} utM؋}D9EseM y}Gy M؉M}t} O UM)щO}(t,},BM(M܉ƒtK }܈O}Ju]$E؋MA @9E}u}؋M +y M$y E؋M +A H}$G EM +A+E}$GAȍP)‰U܋MAȍP)Ƌ}  ]EEEA -M9Mux}urE}9}u&Myt}} OE}?;}t E@9Eu } M M܋} y9M MX}9}u(Myt}} OE#}?;E}>M܉9EEM9Mu@}$GP)‹O ÉU܋E} G)EMyuGE؋}G @9EMyM$ye[^_]ÐUWVS]u S{u"uPSC{WS,uCKu QC9B ~{uA@AC{tBSRSuC두A@ HCu{uA@ CCUUS!XURURURURIQSR?tSC1Se[^_]ÐUWVS]}1C@K,C@PStM@xu 1wPS@RC@PKQK(QWM QuC 0CD9u CDCDPK@Qd_C@tFhe[^_]ÐUVSuF$V V,F0V ҉V4FVtkjVÃtZV,SC@ C@C@C@V4RR_tSV e[^]ÐUVSu]=t 1jU RV_ uhJ_j_}ffUfEEUUEPtPV_ u+=< `#uh_j_t j}_봃%e[^]ÐUE=t1]ÐfEfEtU UEEEPjURW_]ÐUWVS}1ۋU9U u 1[EPW RW$RSU RWƃt/URW$RSURWtt]u1e[^_]ÐUVS]uC 9vC\S6jjR&_uVU RR_ 9tS(CS1e[^]ÐUS]C 9EsC_Sjj Q_u C PM Q Q_S 9tSCS1]]ÐU@EPUR_fEf ]ÐUh)UR/]ÐUh+UR]ÐUjUR_]ÐUhUR_]ÐUURU RUR_]ÐUURU RUR$_]ÐUUR_]UURT_]UEP)_UU)Ѝ<]ÐUb]ÐUS]M 1ҡb tB됐]]ÐUEbE b]ÐU< `]ÐUUR_]UUR_U]ÐUU1vvfvfvfvf@]ÐUfUf~ ff~ff~ff~ff~]ÐUWVSfEH#4h>w<t$8<,+(9s2v (QPh(r(ǁ(=,(5(]VfEEEʚ;t%C9r9Ev ]EUڋu݃}t7M9M9U)v EPREfE:Ћt" S)vsPRff@f~ȁ'w`,+(9s2v=(WP_h(2(( ,5(();:Vr5e[^_]ÐUVSu fEH#h>ww 4S ^4e[^]ÐU9~$9~(,]ÐUVS]f9sDPXP‰։uKȉ1BE)ЉEEe[^]UWVSu] }Wtr+tttH)‰Pnuhgh `_e[^_]ÐUWVSuVE} P%EuMEu hh `_>;9Ju6VE} P} 77u}7e[^_]ÐUVS]u URlSPe[^]ÐUWVSuf] Ãǃ9==tIfbJ#hU+b )щ9r MQR$ bHP}PP b bMfb FBfKf)==bEe[^_]ÐUVSEM fpFAfJfe[^]ÐUVSEu fXFC8t1fIfe[^]ÐUWVS} ff=(SWKURS_4f@VSWURSV_SV[^_]ÐUWVS=EtlbW_G)E9_vLUփShR_Sh `+h `j _tu%9_w?uURh_e[^_]ÐU]ÐUWVSf} ft>UffT R)fÍIf÷f]fEEfE>ft54f9{uURRufCfuf<<98ujh8h4 <4PUROf{EfE>fSf<fE><e[^_]ÐUE U98s]ÐP4R]ÐUU4Љ]ÐU<]ÐUVSuSE PqVS_[^]ÐUVSf95<|4Sh> _Sh `h `j g_fFf95<}͍e[^]UVS1ShC _1f]>ft 4fBf\fuPhG s_fE>ft,h `j _Sh `4f\fuh `j _fFf`<PhK _e[^]ÐU1ҐfE>fBf~f<jhZ f.]ÐUShgu1=lgt@Kind == kClass_declarationec1.c%s:%u: failed assertion `%s' classClass database "%s" not available (status=%d) Cluster: "%s" already exists as: "%s"%s: *** Database error: could not insert class (id=%d) insert classPLATFORMGENERALANYANYt_node->Kind == kTagged_index_clause || t_node->Kind == kSimple_index_clauseec1.c%s:%u: failed assertion `%s' t_node->Kind == kClass || t_node->Kind == kClass_header0 || t_node->Kind == kExpanded_class || t_node->Kind == kDeferred_classec1.c%s:%u: failed assertion `%s' No class definedClass name must be the same as the source filet_node->Kind == kFormal_genericec1.c%s:%u: failed assertion `%s' VCFG-2: "%s" appears more than once in Formal_generics_partANYt_node->Kind == kIdec1.c%s:%u: failed assertion `%s' t_node->Kind == kClass_typeec1.c%s:%u: failed assertion `%s' VFFD-1: Bad message for obsoleteIllegal manifest constant%s t_node->Kind == kParentec1.c%s:%u: failed assertion `%s' Cannot update rename table for "%s"t_node->Kind == kRename_pairec1.c%s:%u: failed assertion `%s' VHRC-2: "%s" appears more than once in Rename_pair listVFFD-2: Feature rename. "%s" already exists%s_%d_%s_%sVHRC-1: Feature rename. "%s" already existsFailed to insert rename link '%s'VLEL-1: All appears more than once in export feature listt_node->Kind == kNew_export_itemec1.c%s:%u: failed assertion `%s' VDUS-4: "%s" appears more than once in Undefine listVDRS-3: "%s" appears more than once in Redefine listload_feature_listt_node->Kind == kFrozen || t_node->Kind == kIdent_name || t_node->Kind == kInfix || t_node->Kind == kPrefixec1.c%s:%u: failed assertion `%s' Append_feature_nameAppend_feature_nameAppend_feature_nameAppend_feature_nameunknown operatorAppend_feature_namet_node->Kind == kCreation_clauseec1.c%s:%u: failed assertion `%s' VGCP-2: Feature name. "%s" appears twice in creation list%sProcedure name requiredload_client_listFrozen keyword out of placet_node->Kind == kFeature_clauseec1.c%s:%u: failed assertion `%s' NONEt_node->Kind == kFeature_declec1.c%s:%u: failed assertion `%s' VFFD-1: Feature type for "%s" unknownvoidvoidBad feature_typevoidVMFN: Feature name "%s" already exists%sCurrent%%%dVMFN: Attribute name "%s" already exists%sget_new_feature_listt_node->Kind == kDeclaration_bodyec1.c%s:%u: failed assertion `%s' t_node->Kind == kDeclaration_bodyec1.c%s:%u: failed assertion `%s' t_node->Kind == kFormal_args0 || t_node->Kind == kFormal_args1ec1.c%s:%u: failed assertion `%s' t_node->Kind == kEntity_decl_groupec1.c%s:%u: failed assertion `%s' Current%%%dt_node->Kind == kLocal_decls0 || t_node->Kind == kLocal_decls1ec1.c%s:%u: failed assertion `%s' t_node->Kind == kLocal_decls_list0 || t_node->Kind == kLocal_decls_list1ec1.c%s:%u: failed assertion `%s' t_node->Kind == kEntity_decl_groupec1.c%s:%u: failed assertion `%s' $RESULT_TYPEt_node->Kind == kList0 || t_node->Kind == kList2ec1.c%s:%u: failed assertion `%s' ::BIT*%s[type = %d] t_node->Kind == kRoutineec1.c%s:%u: failed assertion `%s' routinevoidt_node->Kind == kDo_body || t_node->Kind == kOnce_body || t_node->Kind == kExternal || t_node->Kind == kDeferredec1.c%s:%u: failed assertion `%s' t_node->Kind == kCurrent || t_node->Kind == kResult || t_node->Kind == kIdec1.c%s:%u: failed assertion `%s' Currentresultt_node->Kind == kExternalec1.c%s:%u: failed assertion `%s' REI*Invariant*ew%s: Cannot create temporary file "%s" (errno=%d)%s: Cannot access temporary file "%s" (errno=%d)r%s: Cannot open temporary file "%s" (errno=%d)get_comment%N--Illegal manifest constant%ldIllegal manifest constanttruefalse%fCHARACTERINTEGERREALDOUBLEBOOLEANSTRINGBITNONE%sbad manifest constantclass.edba:v:D:C:c:u: Usage: %s [options] options are: -c Class belongs to -s Class name is aliased to -u Class belongs to -v Verbose output -C Set `case' mode -D Set diagnostics code %s: Cluster not specified^%s~%d-%s<%s%c%s%s Name "%s" clashes with "%s". ec1_hash_list_all#%s Name "%s" clashes with "%s". #%s~1-%s<%s%%%s Name "%s" clashes with "%s". VRLE-2: Name of local entity "%s" clashes with a parameterVREG-%d: Name of local entity "%s" appears more than onceName of parameter "%s" appears more than once in listVRLE-2: Name of parameter "%s" clashes with a local entity%%%s%c%sAnchored type can not be accessed. %sunknownInternal error ec1:print() Can't lookup class "%s"external_addexternal_addexternal_addexternal_addexternal_addCANYANYexport_addexport_addANYCCC~CvCqCjC`CCHARACTERDOUBLEREALBOOLEANBITPOINTERNONEINTEGERdddddCCCCCDOUBLE_REFREAL_REFINTEGER_REFCHARACTER_REFBOOLEAN_REF%*s%s BOOLEANCHARACTERINTEGERREALDOUBLEBITvoidi >= 0 && i < bibt_list_count()classaccess.c%s:%u: failed assertion `%s' Memory allocation error in `%s' (%d bytes)\%o@\b^$\f\\~\n`\r#\t\0|L'%s'%\'\"[]{}%cNONEUnable to find class "%s" to check conformancevoid.e.tPP}P_PZPFPAP@P;P:P5P4P/P.P)P(P#P P PO |OO zOO OO zObO]OGO3BO5O40O O5O OOOOONNNNNNNN NNNNNNE}NdN_NEN @N?N:N%N  NN XNN!ONM"QMM#MM$7MM%LMM&UMM'eMdM(^_MJM)fEM4M*/MM+MM,LL-LL.LL/LL0 LL1n{L]L2nXLCL3s>L,L4q'LL5&LK6$KK7KK8KK9KK:KK;KK<KK=KhK>pcKGK?pBK-K@o(KKAvKJBwJJCJJEJJEJJFJJG{JmJHhJNJIIJ2JJ-JJKJIAddress Argument ValidityVZAARetry Constraint RuleVXRTRescue Constraint RuleVXRCStrip Expression ValidityVWSTOperator Validity RuleVWOEManifest String RuleVWMSManifest Array RuleVWMAConstant Attribute RuleVWCAVWIDEquality Expression RuleVWEQBoolean Expression RuleVWBECall is ValidVUGVCall is Export-validVUEXCall is Class-/system-validVUCSCall is Argument-validVUARUnconstrained Genericity RuleVTUGVTEGClass Not Found In Specified UniverseVTCTVTCGVTBTVTATRoot Class RuleVSRCName clash in ClusterVSCNRoutine RuleVRRRLocal Entity RuleVRLEFormal Argument RuleVRFADuplicate Feature declarationVREGUnique Declaration RuleVQUIManifest Constant Initialisation RuleVQMCMulti_branch RuleVOMBSelect Subclause RuleVMSSVMRCFeature Name RuleVMFNFeature Name ConstraintVMCNExport List RuleVLELExpanded Client RuleVLECExport: Client exists in UniverseVLCPProcedure Call SyntaxVKCNAssignment Attempt RuleVJRVAssignment RuleVJARVIRWRename Clause RuleVHRCParent RuleVHPRClass ANY RequiredVHAYVGCSCreation Clause RuleVGCPVGCICreation Instruction RuleVGCCFeature Declaration RuleVFFDEntity RuleVEENUndefine Subclause RuleVDUSVDUCRedeclaration RuleVDRDRedefine Subclause RuleVDRSVDOCJoin RuleVDJRVDDCVDCNEnding CommentVCRNFormal GenericsVCFGClass HeaderVCCHGeneral Validity RuleVBGVAssignment ConformationVBARLoop Variant is an Integer_expressionVAVEFeatures Available in PreconditionVAPEValid `old' expressionVAOLConformance in ExpressionVNCXSignature ConformanceVNCSVNCNVNCHVNCGVNCFVNCEGeneral ConformanceVNCCDirect Conformance (Bit_type)VNCBSyntax ErrorVUNDonce_addonce_addonce_addgfffffffffffffffffffffff}ftflfbf[fRfKfEf>f7f0f)f"ffff ffeeeeeeeewritereadwhilevolatilevoidvirtualunsigneduniontypedeftrythrowthistemplateswitchstructstaticsizeofsignedshortreturnregisterpublicprotectedprivateoperatornewlongintinlineifgotofriendforfloatexternenumelsedoubledodeletedefaultcontinueconstclasscharcatchcasebreakautoasm -j+j'j %j#jj jjj jj j jjjjiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii|itilidiai^i[iWiSiOiGi?i7i6i5i4iIMPLIESIMPLIESimpliesXORXORxorOR||orOR_ELSEOR_ELSEor elseAND_THENAND_THENand thenAND&&andNEQ!=/=EQ===GEQ>=>=LEQ<=<=GT>>LT<<SUB--ADD++MOD%\\IDIVDIV//MUL**DIV//POWPOW^SUBU--ADDU++NOT!not@ik&ek*`k#[k|Wk!Rk~Lk?Fk[@k]:k(4k).k{(k}"k&k>k<k=k+k-k\k/j$jDOLLARSLASHBSLASHMINUSPLUSEQLTGTAMSNDCLBRCOPBRCCLPAROPPARCLSSQOPNSQQUERYTILDABANGBARHASHSTARANDAT*** Cannot translate operator "" to C _INFIX_FO_PREFIX_FO_%sCurrentNN?ANN?PNN*Currentrruldgeneric_addgeneric_addgeneric_addwCan't open "%s" for case mode outputt_node->Kind == kClass_type || t_node->Kind == kClass_type_expanded || t_node->Kind == kSimple_typeectree.c%s:%u: failed assertion `%s' :>VALID %s(%d,%d) *** Validity check failed: %s (%s): "%s" (see page %d) > %s. SYNTAXSYNTAX%s(%d,%d) *** Syntax error: %s WARNING%s(%d,%d) *** Warning in "%s": %s :t_node->Kind == kId || t_node->Kind == kFree_operator || t_node->Kind == kOp_name || t_node->Kind == kChectree.c%s:%u: failed assertion `%s' Identifier expectedt_node->Kind == kString0 || t_node->Kind == kString || t_node->Kind == kOp_nameectree.c%s:%u: failed assertion `%s' not a string valuet_node->Kind == kInfix || t_node->Kind == kPrefixectree.c%s:%u: failed assertion `%s' not an operator_INFIX__PREFIX_t_node->Kind == kInfix || t_node->Kind == kPrefixectree.c%s:%u: failed assertion `%s' not an operatorInfixPrefix%s "Bad character %c%cBad character 0x%x InfixPrefixInvalid %s operator name"""%ld%struefalse%lGCHARACTERINTEGERREALDOUBLEBOOLEANSTRINGBITNONE"%s"%d:0                               IB:1(נ͠ uhZTE6-# ٟʟ{sgZMF>6%۞Ԟsg^TJ:)ܝ֝Ν{m_SF9)ٜќǜq]H3$ ՛ś|rg\TKB;2.# ՚ȚÚynicXD;/&ߙԙ̙Ùr`ND9.# ݘԘ˘uid[SK<82) ڗϗė|rfZO@6( ҖϖʖĖ}vog`XPIF>5,Comment1Comment0CommentIdResultCurrentEntity0EntityString0StringBitseq_NONE_BIT_STRING_BOOLEAN_DOUBLE_REAL_INTEGER_CHARACTERRealIntFalseTrueChManifest_constant0Manifest_constantList2List1List0ListImplies_binaryXor_binaryOrElse_binaryOr_binaryAndThen_binaryAnd_binaryGteq_binaryLteq_binaryGt_binaryLt_binaryNequal_binaryEqual_binaryPower_binarySub_binaryAdd_binaryDiv_binaryMul_binaryIntDiv_binaryIntRem_binaryFree_operatorBin_opNot_unarySub_unaryAdd_unaryUnary_opStripOldManifest_arrayParenthUn_exprBin_exprCallSimple_exprComment_exprExpression0ExpressionAddrActualActual_list1Actual_list0Actual_listActuals1Actuals0ActualsUnqual_call1Unqual_call0Unqual_callCall_chain1Call_chain0Call_chainType_list1Type_list0Type_listAssertion_clause1Assertion_clause0Assertion_clauseAssertion1Assertion0AssertionEnsure2Ensure1EnsureRequire2Require1RequireCondition1Condition0ConditionActual_generics1Actual_generics0Actual_genericsAnchoredSimple_typeBit_typeClass_type_expandedClass_typeType0TypeLoop_body1Loop_body0Loop_bodyDebug_keys1Debug_keys0Debug_keysRetryDebugCheckLoopMulti_branchConditionalRev_assignAssignCall_instructCreationInstruction0InstructionConst_attrValIntervalChoiceChoices1Choices0ChoicesWhen_part1When_part0When_partWhen_part_list1When_part_list0When_part_listThen_partThen_part_list1Then_part_list0Then_part_listCompound1Compound0CompoundConstraint1Constraint0ConstraintFormal_genericFormal_generic_list1Formal_generic_list0Formal_generic_listFormal_generics1Formal_generics0Formal_genericsEntity_decl_groupDeferredExternalOnce_bodyDo_bodyInternalEffectiveRoutine_body0Routine_bodyFormal_arg_list1Formal_arg_list0Formal_arg_listFormal_args1Formal_args0Formal_argsFeature_list1Feature_list0AllFeature_listNew_export_itemNew_export_list1New_export_list0New_export_listOp_nameInfixPrefixOpIdent_nameFrozenFeature_nameNew_feature_list1New_feature_list0New_feature_listCreation_clauseCreators1Creators0CreatorsRename_pairRename_list1Rename_list0Rename_listFeature_adaptation1Feature_adaptation0Feature_adaptationParentParent_list1Parent_list0Parent_listLocal_decls_list1Local_decls_list0Local_decls_listRescue1Rescue0RescueLocal_decls1Local_decls0Local_declsRoutineUniqueConstantAttributeFeatureDeclaration_bodyFeature_declFeature_decls1Feature_decls0Feature_declsClients2Clients1Clients0ClientsFeature_clauseFeatures1Features0FeaturesDeferred_classExpanded_classClassClass_header0Class_headerSimple_index_clauseTagged_index_clauseIndex_clauseIndex_list1Index_list0Index_listIndexing1Indexing0IndexingClass_comment1Class_comment0Class_commentClass_declarationClasses1Classes0ClassesEiffelNoTree  ! !"#(%&'(+*+.-.1014345878;:;<?>?@CBCIEFIHIJMLMNRPQRUTUXWX`Z_^]^_`adcdgfghkjknmnqpqrutuxwx{z{}~ 9%s %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%s%*cTree: error in GetTree %hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*ccdbchan == -1classlib.c%s:%u: failed assertion `%s' %s%cinfo%s: Not an Eon/Eiffel database. Can't open database `%s'classesFailed to open `Classes' table clustersFailed to open `Clusters' table featuresFailed to open `Features' table parametersFailed to open `Parameters' table suppliersFailed to open `Suppliers' table ancestorsFailed to open `Ancestors' table genericsFailed to open `Generics' table visibilityFailed to open `Visibility' table assertionsFailed to open `Assertions' table cdbchan > -1classlib.c%s:%u: failed assertion `%s' ..........********clusterclustercluster_idcluster_idClass: %s Unable to insert cluster "%s" for class "%s" EDclass_idFailed to delete class entries (error %d) cluster_idclass_nameclass_idclass_idclass_name %s REIversionclass_idclass_idfeaturecodeclass_idfeaturecodefeature_classclass_idfeatureFailed to delete feature entries (error %d) feature_classcodeclass_idfeatureclass_iddas_delete ( Features) failed featureclass_idclientfeatureclass_idclass_iddas_delete ( Visibility) failed Failed to delete visibility entries (error %d) cdb_supplier_insert: class #%d could not be found class_idFailed to delete supplier entries (error %d) supprec->class_id > 0classlib.c%s:%u: failed assertion `%s' supprec->supplier != (char*)0classlib.c%s:%u: failed assertion `%s' strlen ( supprec->supplier) > 0classlib.c%s:%u: failed assertion `%s' class_idsupplierclass_iddas_delete ( Suppliers) failed class_idclass_idgeneric_paramclass_idgeneric_paramFailed to delete generic entries (error %d) class_iddas_delete ( Generics) failed cdb_parameter_insert: class #%d could not be found featureclass_idnamefeatureclass_idnamefeatureclass_idclass_iddas_delete ( Parameters) failed Failed to delete parameter entries (error %d) featuretypeclass_idcdb_assertion_insert: class #%d could not be found typefeatureclass_idFailed to delete assertion entries (error %d) class_iddas_delete ( Assertions) failed cannot determine ancestry of unknown class "%d" class_idclass_idancestorFailed to delete ancestor entries (error %d) class_iddas_delete ( Ancestors) failed code == 'R' || code == 'F'classlib.c%s:%u: failed assertion `%s' code == 'U' || code == 'C' || code == 'A'classlib.c%s:%u: failed assertion `%s' xtplhd`\XTPLDecNovOctSepAugJulJunMayAprMarFebJanSatFriThuWedTueMonSun%02d:%02d:%02d %s %2d 19%2d%02d:%02d:%02d %s %s %2d 19%2d%s %2d %02d:%02d*** Memory allocation failure in `set_varfield1' (%d bytes) Showing keys for table "%s": Currrent key list empty Field = "%s" Direction = ?? Type = Unique Non-unique (end / none) Unknown (%d) ANDOR Conjunction = %s Value = (0x%x) %d %f "%s" Unknown (%d) (empty) ----- *** Memory allocation failure in `set_varfield2' (%d bytes) in %s, table = "%s" %d.%d.%d.%d%d.%d.%d.%dEON/Eiffel. (c) Eon Software 1993 All rights reserved Version %d.%d.%d.%d (patch level %d) EON/Eiffel. (c) Eon Software 1993. Version %d.%d.%d.%d (patch level %d) }.e%s.e%sIn file: %s r%s(%d): ^ At end of file. . . . Compiler Error! Contact EON Support. . . -%d%s%s %s %s %s %d %d %s %c *** Terminated *** Freeing at zero!!! Memory allocation errorTMPTMPDIREON_TMP/tmp%s/%s.XXXXXX%s.XXXXXX%*.*s%s000000*DAT*%s: (%d) %s Too many databasesdi_open_dbNo memory for db namedi_open_db%s%c%sdatabases is closeddi_open_tableNo memory for table structuredi_open_tablecould not look-up file namedi_open_tablecould not open tabledi_open_tableunable to look-up index-file namedi_open_tableunable to bt_open/RO index-filedi_open_tabledatabases is closeddi_open_tableerror finding key in index-filedi_match_startunable allocate space for index-setdi_retrieve_setunable to read header in ib-clusterdi_match_startselect * from %s where %s = "%s" (unique) where %s = "%s" (non-unique) Unimplemented key typeKeyAddressUnimplemented key typeKeyAddressUnimplemented key typeKeyEmpty%u%d%d%ld%fUnimplemented key typeKeyDataWarning: key not in indexdi_find_uniquelocked record encountereddi_retrieve_setunable to read header in ib-clusterdi_retrieve_setunable allocate space for index-setdi_retrieve_setunable to read exising INDEX in ib-clusterdi_retrieve_setunknown read-flagdi_read_reclocked record encountereddi_read_recerror in `store_read'di_read_recread record size mis-matchdi_read_reccould not read extensiondi_read_recordunknown direction flagdi_traversetable has no indexed fieldsdi_traverseunable to allocate space for index setdi_traverseunable to expand index setdi_traverseunable to expand index set (key != unique)di_traverseunable to expand index set(2)di_traverseNo record has been selecteddi_delete_recordAttempt to deleted unselected recorddi_delete_recordcould not free store recorddi_delete_recordNo record to deletedi_delete_dupserror in index filedi_delete_dupsindex entry missingdi_delete_dupsUnable to read index cluster headerdi_delete_dupscould not delete recorddi_delete_dupscould not free store recorddi_delete_dupsUnable to read index clusterdi_delete_dupsCouldn't find key in clusterdi_delete_dupsCouldn't re-allocate for new cluster. di_delete_dupsCouldn't free old cluster. di_delete_dupsCouldn't re-insert new cluster.di_delete_dupscould not delete recorddi_delete_uniqueNo record to deletedi_delete_dupscould not free store recorddi_write_recordcould not allocate store recorddi_write_recordcould not write to storedi_write_recordcould not write to storedi_write_record(key exists?) Unable to insert into index %s'%s'di_insert_uniqueNo record to deletedi_delete_dupserror in bt_find index-filedi_insert_dupscould not create new INDEX clusterdi_insert_dupsunable to read exising INDEX cluster headerdi_insert_dupscould not allocate temp set spacedi_insert_dupsunable to read exising INDEX clusterdi_insert_dupscould not write swapped INDEX clusterdi_insert_dupsCouldn't free old index. di_insert_dupsunable to re-allocate a larger INDEX clusterdi_insert_dupscould not insert re-allocated INDEX clusterdi_insert_dupsNo memory for 000000 namedi_newdir%s%c%scannot access (existing) database dirdi_newdircould not create database directorydi_newdirobject exists and is not a directorydi_newdircould not change perms on existing databasedi_newdircould not allocate new file-namedi_newindex%s!%s%s%c%scould not open/create index filedi_newindexa+could not open database 000000 filedi_newindex%s %s %s could not generate new data-file namedi_newtable%s%c%scould not store_open (create) new data-filedi_newtable%s|%d|%d %s|%d|%d|%d could not write to schema to storedi_newtablecould not write to schema size to storedi_newtablea+cannot access database directory filedi_newtable%s %s %s error creating index on tabledi_newtablestore label record baddi_getschemaunable to read schema record sizedi_getschemaunable to read schema recorddi_getschemaerror copying header from schemadi_getschema%[^|]|%d|%d error copying header from schemadi_getschema%[^|]|%d|%d|%d error scanning in field descriptiondi_getschemar%s!%s%X %*s %*s %X %06Xerror in DI routine "%s": %s rcould not open 000000 filedi_read_dir0.tmpwcould not open 0.tmp filedi_read_dirrcould not open 000000 filedi_read_dir%s %s %s %s%c%sLocked - waiting. $A serious error occured while the database was being processed. %s: (%d) %s Failed to open databasedas_open_dbEON_NOLOCKTable does not existdas_openFailed to open tabledas_openFailed to close tabledas_openFailed to delete tabledas_delete_tableNo memorydas_makekeySingle field onlydas_seekFailed lookup field namedas_seekdas_seekError reading recorddas_read Error %d: %s Extra information: Error %d: %s Error from STORE routine Operation system message: %s. Error %d from `das' routine "%s": %s Error %d from DI routine "%s": %s Error from STORE routineOperation system message: %s. Failed to get current directory namedas_fullnameFailed to change to database directorydas_fullnameFailed to get database directory namedas_fullnameNo memorydas_fullname%s/%sDatabase does not existdas_fullnameNo read permissiondas_fullnameNo write permissiondas_fullnameCan't return to local directorydas_fullnameOut of memory. %s: set is void s%s: set has %d item%s: [|%s%d] unable to allocate space for %d set-items $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stalloc.c,v 1.1 89/10/24 10:09:12 mjr Rel $|FREE LIST DUMP %x %d: SIZE %d ADDR %x NO FREE LIST $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stclose.c,v 1.1 89/10/24 10:09:13 mjr Rel $$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/sterrs.c,v 1.1 89/10/24 10:09:14 mjr Rel $t/ record too smallno such recordrecord I/O errorbad record headerno record errorcannot open?%s P%s: %s X$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stfree.c,v 1.1 89/10/24 10:09:14 mjr Rel $d$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stgethed.c,v 1.1 89/10/24 10:09:15 mjr Rel $$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stopen.c,v 1.1 89/10/24 10:09:16 mjr Rel $($Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stputhed.c,v 1.1 89/10/24 10:09:17 mjr Rel $$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stread.c,v 1.1 89/10/24 10:09:17 mjr Rel $$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stunlink.c,v 1.1 89/10/24 10:09:18 mjr Rel $H$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwrite.c,v 1.1 89/10/24 10:09:19 mjr Rel $$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwsuper.c,v 1.1 89/10/24 10:09:19 mjr Rel $$Header: /atreus/mjr/hacks/btree/btlib/RCS/btclose.c,v 1.1 89/10/24 10:08:55 mjr Rel $h$Header: /atreus/mjr/hacks/btree/btlib/RCS/btdelete.c,v 1.1 89/10/24 10:08:56 mjr Rel $$Header: /atreus/mjr/hacks/btree/btlib/RCS/btfind.c,v 1.1 89/10/24 10:08:57 mjr Rel $ $Header: /atreus/mjr/hacks/btree/btlib/RCS/btgoto.c,v 1.1 89/10/24 10:08:58 mjr Rel $|$Header: /atreus/mjr/hacks/btree/btlib/RCS/btinsert.c,v 1.1 89/10/24 10:08:58 mjr Rel $$Header: /atreus/mjr/hacks/btree/btlib/RCS/btio.c,v 1.1 89/10/24 10:08:59 mjr Rel $4$Header: /atreus/mjr/hacks/btree/btlib/RCS/btoopen.c,v 1.1 89/10/24 10:09:01 mjr Rel $$Header: /atreus/mjr/hacks/btree/btlib/RCS/btopen.c,v 1.1 89/10/24 10:09:00 mjr Rel $$Header: /atreus/mjr/hacks/b+tree/btlib/RCS/btpage1.c,v 1.1 89/10/24 10:09:02 mjr Rel $D$Header: /atreus/mjr/hacks/btree/btlib/RCS/btpage2.c,v 1.1 89/10/24 10:09:05 mjr Rel $$Header: /atreus/mjr/hacks/btree/btlib/RCS/btravrs.c,v 1.1 89/10/24 10:09:06 mjr Rel $$Header: /atreus/mjr/hacks/btree/btlib/RCS/btseek.c,v 1.1 89/10/24 10:09:06 mjr Rel $X$Header: /atreus/mjr/hacks/btree/btlib/RCS/btzap.c,v 1.1 89/10/24 10:09:06 mjr Rel $Seek errorRecord locking deadlock$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stcopy.c,v 1.1 89/10/24 10:09:13 mjr Rel $8$Header: /atreus/mjr/hacks/btree/btlib/RCS/btlabel.c,v 1.1 89/10/24 10:08:59 mjr Rel $$Id: System.c,v 1.8 1992/09/24 14:20:40 grosch rel $rrb$Id: General.c,v 1.5 1992/05/05 13:19:05 grosch rel $$Id: Memory.c,v 1.13 1992/06/24 12:23:15 grosch rel $$Id: DynArray.c,v 1.6 1992/08/17 11:42:24 grosch rel $MakeArray: out of memory ExtendArray: out of memory $Id: StringMem.c,v 1.11 1992/05/05 13:19:05 grosch rel $%8x %5ld Bytes $Id: Idents.c,v 1.12 1992/05/05 13:19:05 grosch rel $04%5d %5d%5d Idents = %5d d   ``/x ?`0  p`eon3122/bin/ec2000755 000000 000001 00001072004 05710535132 013440 0ustar00rootother000000 000000 d0@-̀\ `D$4 `gPP`[̀UWVS] RGEPh( `P1EPh( `}~sT0uj`h@;誸h@;SUR軹ƃu 蜾j`h 3h3h3h,vh_jG `9u~FE1;0щMQU`EUPUR `EF 9uh@;׸u jL`=D;t@;PhZ0c`^$`;=lCtlCR@;Ph$$Xh$|h$j/h`?hp0h& `hy0h&U`à u< `Rh&h{0x S&ES`EPO =\; S}`\;R Eu-\;Ph0h `hURj6V{M=,Du-0Ph0h `hURj {dCPh$hh`?h0h& `h0h&Y`EH0 u< `Rh&h0w jH0P8=0t.0Rh1hB `hEPj6~zuj8f6hCRh$hL1:h_1:0Ph1:h19 h19h19h19h19h29h,29hA29h\29 hu29=L;t!h29h2x9h2n9 h2a9h2W9h33M9hH3C9hb399hy3/9h3%9h39 h39h39h380Rh38\;Ph38\;RPm$gqE~EURZ\;P[$SYË\;Rh 4hs`hSj6x qj\;PR qE0D4 1t FO)ȃ t>URZ\;P[$SYhQ4h`hSj6,x#h47h47h47h47h47h47h 57B3h%57h057 30RvZh45l70PZ0R%\j;42=tCtmrj:_UE@@P]ÐUWVS]SRj=D;%P`CR/h`;0R<0Rh65s39&PL )ȍ40=\;t(\;RQ?bu\;Rhb5shCRh,h5h&`h5h&_D0u< `Rh&h5 P@]h$7. P0]h-7 P ]C f8 u"#3h1793S Rj/ h?7SR Cf84u,2hE722ha72SR ^50}7tG507t0507 tv2hCRh7282hCR0RI Ph7W2j0Cf8duP`0C(f8ƒ 0SR Cf84u&h71jh7SR {T507t;507t$507 t h71h81h 8z1h8p1h%8f1h78 9u h?8G1EPjƍF$ t D 4 $  hSj~URhY8h`hSj+>URhv8URh8URh8hY`hSjphSj{pr jSRPVjSREVSRl =,Du1u$h8h_hSj(p=,DtVtREPj4~Vh9h_ hC9h_hSjo C f8?u9=,Du$ht9hT_hSjoS RzURSRS$RZS$R-SRS(RdES$RS$R [$S边9蔼.UR^jD0R#jH0R#.h9.= 0t+jD0R$= 0tjH0R$h9q.0Rh9`.h9h9L.0RRRh:9.$h#:,.0Rh*:.hB:.@hCR0R h]:-= 0tjD0R#hu:-0Rh:-j*j*e[^_]ÐUVS]SDR-ƋSdR`PCLPSHRnfPVRSh:M-e[^]ÐU VS]SDRx-ƀ{#tC#CP]S__SnSj/FmPh:h,_e[^]ÐUWVSu:+N3EEPh:,EEP+3Ã{ts0҉tuEu;u h;-,CPEPi_EuGEPC PzEPhd;+PP`SPbhp;+ ut;u hy;+EE9Eh;+}t1e[^_]ÐUVSEf8 u51Xf;u*~ h;'SR[ Ff;tٍe[^]ÐUWVSE=Cuh;h;*Uf:uJjBP7oÃt!0҉߈tSh;*Ur Epf>ujVRftjFPnE}01ۃtrEPEPM<ǃuURh;kQ?"t!?\t=Ct?;tWh;)]}0щʃ9r}~ h;)N Efffh;)e[^_]ÐUVSMu E]t$tL8t&SPVQ7'SPVQQh;jT1e[^]ÐUWVS}uf?t X~ U R7%URWRWSJ tSh;(URFPU R We[^_]ÐUWVS} uMf9t wURMIQlSXJ t~W$ GPh;"(Sh;(URFPWMI Qoe[^_]ÐUWVS}uf?t YjWRlSI t~h;'D#U RSRh;' F렐e[^_]ÐUWVS]} uf;u3~ W#SRlPh<9'URFPW[ Se[^_]ÐUS]jjSR耘Ph 30 3t, t=t+3,N,E,D]]ÐUh<0Rh<b&]ÐUU RURjPh<5&]ÐUSEf8u@Pr!SU Rh<&]]ÐUWVS]} uf;4uVWSR@FPW[ Se[^_]ÐUVSuf>4u=jF@PSdj:S_tSF@ Pv V[^]ÐUVSuf>4u_VRij:Ss_ t%hCRS6PPh4<$$ShF<$v Ve[^]ÐUEj@Ph8hcj:h8h_t8h]ÐUWVSURPÉ޿Q<Dž 1t FO)ȃu L0jjh\<St}~ U Rh S $jMIQV cj:V/_ÃtVSMRSpLt, 0QVh]<h_hURj!c[^_]ÐUVS]u f;8u5VSR%VS R VSRqVSR V[S e[^]ÐUVSu] Sh<#SVh< #e[^]UWVS}f?REPWR] URRNÃu(URh<h_hWj?bURRpNÃu3URh<h\_hWj-bURRW 0R'S|_u 01(jSR;þ =Cu h<!URSKPh<!URRWURU R<t<Ph=!$URR-Wh={! }t URM_U R WYe[^_]ÐUVSu] f>;u(Sh=$!jh/=SV&h2= !e[^]ÐUVS]u f;;uVSR%E@PURV[ Se[^]ÐUHWVS}EPWREPW R URuV_VR\1 URV_VRRËURV_t 9tVR1t(URh4=h_hWj"=`4U RURPKà u,URU Rhj=h_hWj"_COPCdPCQPPCWPCHP{FY%P{SY%PC'P0RRUR0tPURh=\ URRTURR$jh=UR_uD{HAt>{HCt8{HUt2{HFut(URh=h_hWj"_ jh>UR__ u3{HFut(URh>h_hWj"^}t UR^_}t URL_e[^_]ÐUEf8MuU RP ]ÐUVS]u f;MuVSRV[ Se[^]ÐUEU Rj@ Pk]ÐUEf8RuU RjPHW]ÐUEf8RuU RjP']ÐUWVSMf9REPQRjjhR>MQ,} } q} ft.URhS>h_hMIQj$]UR QHÃt{dt2URMQh>h_hURRj\ʽ{SY%9t5 0QURh>hI_hMIQj\yS'R,uo{HAui>tR{JNt9MQ0RCJPh>S_QSRMQURMQtPGÃu2URMQh>hs_hURRj[裼{FYu.MQh?h?_hURRjx[o=Cu=u={SYu.MQh2?h_hURRj2[)t4{SNu.MQho?h_hURRjZ{HUt {HCMQh?h~_hURRjMQRDFÃt 9uMQUR5Ãu.MQh?h_hURRjIZ@MQS*Ã{FYu.URh@h_hMIQjZ{HUt {HAt{HCu.URh3@h_hMIQjY軺{OYu.URh]@hW_hMIQjY臺{SYURh@h_hMIQjfURMQ4Ãt+URh@h_hMQj)Yu+URh@h_hMQj)XUR_MQU RMI Q[^_]ÐUWVSu EEFEt1<H7I>UZ  H FtbIRj[ S=\|P]S_0щ|Q_|u"0щ|QhA)SR_FS_|P]S_0щ|Q_|u"0щ|Qh'A(SRb_E@ Pr]|PSI_0щ|Q_|Fu"0щ|Qh;A((SVR_FYS"^|P]S_0щ|Q$_|u"0щ|QhOA'SRr_E@ P\|PSY_0щ|Q_|Fu"0щ|QhcA8'SVR_FYFYFjE@ PY|P]S_0щ|Q,_|u"0щ|QhwA&SRz_FUJf9iNEP\|P]S3_0щ|Q_|u"0щ|QhA&SR_EPZ|PS_0щ|Q'_|Fu"0щ|QhA%SVRs_FYF EP[|P]SC_0щ|Q_|u"0щ|QhA#%SR_EPZ|PS_0щ|Q7_|Fu"0щ|QhA$SVR_FYFEPhAT1VR4|tFp[^_]ÐUS]f;?uSR[ S]]ÐUS]Cf8u @PgCf8%P[ S]]ÐUWVS}f?R*wf>FjV RwVP]Sq_jjhAS u%ShAh_hWjRSWu%Sh!Bh_hVjQ޲=\;t?} t9S\;R_u%ShBBh`_hWjQ薲0RWu1G f8Ru(EPhBh_hVjZQQU R Wt[^_]UVS]johB f;uSR[[ f;t j1 ? SRb[ f;te[^]ÐUS]Cf8u @P7[ f;!ujSR=[ f;!t]]ÐUWVSuf>jVRUTS}Q0RS4_t2e[^_]USEX f;!ujSR[ f;!t]]ÐUlWVSMI PjUR(0IQËBSP_I(uADž;*u!jS Q(PEP_SEP_}u|%t|6'-Ph?CPheCh_ =thURjM 0QEP_EP PS_ 0RS_ ,0ۃv 'u?B f8Tt0PhCh_hMQjUML(u`PRAE1ۃ9};SP QERCSjPQ@PUR$9|ȃ} t619~, QPR Rp C9ԋP Q>ÃttuVS_tcSS_SVa$u2SVPhCh_hURj4L (SbPP=_ 19h\QRPQPRMQUxt@PuRRaP Q7ƃDž~[Yu(%~JFu<R@PP 0QhDR_{~JAuJ Q@PP0RhDQv_Dž2R@PMPQ_uR8P_09D0=Cu h"D (u h*D 't&uAf8t h3D RQh:D jRQEPRv (t h@Dp ~JFNPQhCDC  ~[YuPhUDRh_D hbD(Q0R4PQhgDSRj(EPQ$hqDuD1t FO)ȃtRhzDc8PhDOA f8UuhDPhD%hD09D0=Cu hDRQ@PhDX=Cu hDR@PQhDxC9RP(0D[^_]ÐUWVSEU 9U']URPURU Rt,PhDh_hURjG}`u2xYu*Ph)Eh_hURjFƧxYU:tu\Eu*PhaEhA_hURj}FtPR:>~,PhEh_hURj4F+xYU:tuEu*PhEh_hURjE٦PRY:4>t,PhFh\_hURjE菦0RPuZPtIPR9=t,Ph.Fh_hURj*E!RPtGURP3t2UR0RhbFh_hURj(D¥}^} u,PhFhP_hURjD胥URRRP~_t,PhFh_hURj?D6EU 9Ue[^_]ÐUWVSUE~7] <49t MQP_u  9|1e[^_]ÐUWVS] DžtMA @l|(t%&uuPjMQN ǃ u1WUB @Pa8*u)jP QPEP<_PEP"_}u 0REP _EPx QPp C$d;D<$>4=?;19\PR.ƃu1Ph Gh_hMQj?$BVj@PRMI QGxREP &Q|RlQ(C9^19xPR5-ƃu1Ph"Gh_hMQj?WANVj@PRMI QzxREP &Q|RlQ(=,Et DžtC90x19PRF,ƃu1Ph7Gh,_hMQj?h@_Vj@PRMI Q苡pu;jEPRP Q0 P&RhLG DžtC95x19pP QI+ƃu1Ph^Gh/_hURj?k?bVj@P QUR R莠xQEP&R|QlR(DžtC95x19pP QY*ƃu1PhsGh?_hURj?{>rVj@P QUR R螟jEP Q PRL P &QhGC9BWP}t`[^_]ÐUWVS] EuGuB%t|;'6URhG URhGhI_hMQj=|UR Qy/ƃ&t'rUB$@DA$A$AA4AaAaAaAaAaAaAaAaAaATATA}tGK}t7;Ev"&}t}tE}t+MQhGh6_hURj/r<ijMIQmËUBf8=Gt%h7HGh;Ht~HFu hBHSMQhGH=GthNHG hRH}t"hYHhZ_hURj0;t~HFu hHGMQ !PURhH,e[^_]ÐUS]} %u(}u ShHURkPShH]]ÐUWVSMA @f8%PjQxUB @P PuV_}u 0QV_VH |1ۃ9xktPR"&ƃu1PhHh_hMQj?D:;Vj@PRMI Qg} u&RhH &QhH|tc} uMtHt&RtQhH&R 0QhHX G&RhI.} u &QhI&Rh-IhGIC9xxQPh[^_]ÐUWVS}G @f8%MPjWxG @PP]S_}u 0RS_S;|1ۃ9xPR$ƃu.PhJIh_hWj?C8:Vj@PRW Ri|t$&RREPh_I&RRhI :5hIC9x'xRPl[^_]ÐUWVS}u ~N~L;t;xtP9t R_8t P_ Q_9|e[^_]ÐUWVS}u uf?Ctj_ÃujhI(CNC NCNCNtMD@ C 1G C Nf8#u@f8(u @f8`uC YUD QWRFRe[^_]ÐUS]}(u@C f8Uu*hIhIS RBhIhI}uS RURU R[S ]]ÐUEf8Ut1]ÐjU R@PQ]ÐUEf8Ut1]ÐjU R@Pa]ÐUWVSu} ]f>Xt *~ WJVRSWv Ve[^_]ÐUWVSu} ]f>Xt *~ WVR:SWv Ve[^_]ÐUWVSu]}f>1t 1?}~ U RWSVRWjE@PU Rv VÉ؍e[^_]ÐUVSuDžV ROS 0R,_ uVhI5Pjj:S)PsP.SR PPhJSm_jjSvV[^]ÐUEjjh J@P]ÐU0WVS]}ES REC f8‰EURjj:EPm EPEPS-URP,EPCE$UR 0P_EuSh Jm4ԓjURCPs fffE <}f>ujVRcjFP6ÃS:tRjjLEPSV}0щMU| *u}щMD }u/EPEURĿEj~_EUujh'J0щMQI_EUE8u0щMQh>JSUP_}0щMQ_EUBE xu }0щMQhUJgUREPR*_EE N fffBE e[^_]ÐUWVSEMf9ulJ8iUle$MMNP$PDPjMIQj4Ph8iC_h8iPc*ËUB f8u;hmJh8i_EP08i7iPUR RU3}t6u:h8i~(PhoJhr_hMQj(PhJh2_hURj!ulRjVR1ۃ 9}DPU RPƮ_ uWR9C9|v f>!tR f:iWPE[^_]ÐUS=P;=D0t8D0R_hCR0Rj/h`?hU]S譭_S_ =H0t8H0Rǣ_dCR0Rj/h`?hV]Sl_SƯ_ 2h(h Vh `^jc_US]hVS_ShLVS_hcVS_S@ hVSң_]]ÐUjhCRñhVhVhWhEWhgWhW hWhWhWhWhW~hXth.XjhX` hXShXIhX?hX5h,Y+hYY!hrYhY hYhYhZh"Zh;ZhpZh~ZhZ hZhZhZh,[jhCRUh;[whS[m h[`h[Vh[L][[[[\UWVS}|b1ېhCRTRPh\UR赡_C~1ېTRh'\UR蕡_hJ\UR臡_h^\}Phb\URn_$h\aPh\URR_h\HPh\UR9_ h\UR(_TRh\UR_C`e[^_]ÐU3H940u3Rh\V4040RUR٦40]ÐU WVS] EEEu(h]f0Rh9] uAh0Rh]]w20RRh]`0Rh]Oth]9SEPEPEPUR@50]1t FO)ȃ50] 50]tm}ugh]u h]"Rh^uh^}#R0Rh3^X }ujhe^Euhh^%3Rh^uh^ #3R0Rh^ }ujh^uh^%Rh_uh_#R0Rh,_x txu,0Rhb_[h_Q h_6u0Rh_h_h_e[^_]ÐU WVSSEEM9HU]T RԥEh_}u]Sh_6MUL Qh_[}u"URh_D2]M\ SMQ0Rh_u#`u ] u'` u Mu0`u UE]M9Ye[^_]ÐUWVSEPEP[8m8m'P؎PuV谥_EPEP+8m8m'P討PS}_0҉у(|)*uD)߈у)*uƄ)} t&VS_tXVEPSEPh8`$VSu2VEPSEPhl`hu_|EPEP+ EPEP EPEP=EPEP*ƒ 9tiR`u`RPEP`} t`Rh`EPE PEPEPSh#aw9uPPSEPEPxPPSEPEP\(P͌PV訣_P贌PP艣_0у|)*uD)0у)*uƄ)}*u jVP *ujPP_ } tNRP轢_tREPE PEPEPSh`h0_:RPW2C9e1[^_]ÐUWVSu1ۋ=W=W1҃9Y~D 9t B9Qt$h]ah臡_hvVj!re[^_]ÐUWVS} Q 1҃9}WEPEPZS Q舘MQ}(MQhah_hWj<3r9|e[^_]ÐUVS] S薨SΞV ~ctxQEuXVÃtASHVx~tրxQEu1e[^]ÐU9ha"Rhae u00Rha0RRhbRh;bu00RhEbg0RRhabRhbՑu2U0RRhbc0RRRhbKRhb苑u2 0RRhb0RRRhc0RhNc0RRhnc0Rhcv0RRhc(|0RRhdE0RRRh$drM0RRhfd[(0RRRhd@]U WVSDžUR RP]Sf_޿d1t FO)ȃ u*(0RP@[NSRu10PURhdhp_hEPj nUJf9x'*u#j'PR 'ueheRHRsPheh貜_hURj m=Q9*u jQPB RWÃuPhUeh_ tRtPh{eh_ 'VRu?PPS_VPSheh膛_ =thURj l DžPRPà t:RPheh_hEPjB 9ltGS觶u:RPhfh趚_hEPj k]޿Lft4zMYu(ShSfhl_hEPj kUfu'hfh%_hEPja XkR艃PS^_0щ *uщƄ RjPRE@P(k&Rt&SASIt"S&Phf] ]z[Yu$&Phf0S&RS&Phf hfURf:x[Yu-xHAu'&RhfxP觘_ &RxP_t!VxPPhgtxPh#g['RS螘_jjxVPSURRW V 0P`_t+Vh(gh_hURRjih`gBVzt1EPhcgh蘗_hURRjV׳h[^_]ÐUSU=t/ =tt=t)ggfgVjR| Ã=00t! (0QS 00Q Q?tÉRhg1]]ÐUWVSE 0RMQ_Uf:jMQRMP QPS˖_޿gDžtt1t FO)ȃt4S|-ShgS_URS% |UB==t'=tI=gMfgfQgQ=,0t3=dt*hghW_hMIQjf=80u<=<0u3=du*hhh_hURRjKBf|9 thBhURRj?"f MIQZP]S(_S|RxRMQV_x'PUR_xQjS|RMIQe$}t>xzWYt2PVhChh._hMIQjg^e]޿htJS诏t==80u4=<0u+ShhhΓ_hURRjd &QhhhhxBHPhhMQUREP|QURhhf}|Q脒P(0R 0QShhh_hURRj?V(Jd-MI QURRMIQURhih[^_]ÐUWVS}E} URM Q0URVb=Ãf?tM$PMQURVPhihG_hMIQj= iVUREPMQURM QjhRiWR[$9]t:MQSURMQPhUih֑_hWj=$ ce[^_]ÐUWVSu]}(f>uq~U R_jEEPj:SEV荒EUEEPE19EEEPEP_SEPӁhmEP轊_E19jEPj:EPƃC9~><|FPhm膊_jEPj:EPhkhm>_Vhm3_ 0щM|>umщMƁm Vhm _9} me[^_]ÐU<WVSDžDžƅURRPuV諉_V Q&Ãu(Vhkh_hURjQHZSjV QURR~Z &Q`PC_S>kDž1t FO)ȃthFkCHPt1RhLkhk_hMIQj$YS[jC'P QPSP`V蒈_R &Qg$t DžUB f8uI`PhskMI Qwk {k QjjVPSUR RVdtMSt@S`PhkSO_WMPhkP7_ S{t'`PhkP_Dž;YuEPhk`PhkP_ PWĵW[Euu hk P萶t hkzjS Q&PRPS誆_`kDž1t FO)ȃu hkYu hkhkRS uHSPS_QPShkh芅_ hURj V[^_]ÐU WVSMIQSR)PjS QURV޿?lDž1t FO)ȃ thGlBHPt+ShKlh賄_hMIQj$Uj'SRXV QPWԄ_jSR-ƃ(Vt5VPhzlh)_hMIQj%bYUVSq_&REPa_hlj踯蓯 &QShlݳ$yS&RShl³S耋ƋMA f8u.Phl l[WÃu hlcjjWPPUR RuVhl/hm"]SSShm 觮SSh>m 莮hMmϮzShSm˲ڮeh\m跲[^_]ÐUS]h`m/.SR6C f8nu P4 hfm.]]ÐUS]pt5qu0SR3C f8qu­him[ S]]ÐUWVSjjhvm|P]SURR4޿~mDžxx1t FO)ȃt+Shmh}_hURRjARhmlj)TMI Qcl[^_]ÐUS]Ԭhm,jS#]]ÐUWVShmjjhm|P]xSURR$xm1t FO)ȃt>xm t'hmh^_h]Sj.Qh nP?h%nju'n1t FO)ȹuQUR RjȬ裫h/n]Cf8mu5耫h9n(0RdP0SjphAn贯 PfBhn蔯裫螫)hn{躊t*hnhL_hURRj.|Pԓl[^_]ÐUWVS]}utt1uu,~ VZU RSR*VGPU R[ Se[^_]ÐUS]f;xu/U RSR6衪[ SdChn蕮褪]]ÐUWVS}z{_f;}eދC9E u C 9E t$hnh~_hSj.ULOFf8uP Ëv Vƃ94SjCho3 u'hoh}_hWRj.NOShDo蠭C9~jPXjv Vp9SjChNo談 u'hOoh,}_hWRj.h_NǨC^vShoPhoC9~9f;~uU RS@f;u U RSU R W0e[^_]ÐUWVSu} F9t'hohc|_hVRj.MjVRVROSjCho萆u'hoh|_hvVj.MDM謧uShpShpe[^_]ÐUWVS}] EPEPEPWR,EPwƃ9]t'h*pho{_hWRj.L}Ct-}Ut-hkph<{_hWRj.xoL}UuJ95tBVRu.0Rhphz_hWRj.(LUREPUR* u3q}UupPhz_hWj.K:}uURhYqURhcqne[^_]ÐUS]hoqKj(0R0Rjihq[Shq!]]ÐUS]hqCf8uhqjjhqSRbj茦S RCf8u hq訩hq蛩]]ÐU=du'hrh]y_hURjJJhArOhCrE(0RX^P0RhXr"hrhr hr]ÐUWVS]uKQPP0y_C f8uPiPEPy_ EU0tM QSQVD޿r1t FO)ȃuIQ 0Q 0QM Qsx_rurRhr @Q 0QM Q1x_rurRhrɧ[^_]UVS]u ff`f=t =tCD[RV@ju+hrhQw_hSjH[f;C f8h8s&hPs転jhs 襢hsdjV0Rjdhs[ Sk d,mhs迦΢jwRhs褦hs蚦ht萦e[^]ÐUVS]u ff]f=t =tCD[RViu+h.thv_hSjPGG[f;C f8hlthtܥ{jht˥躡eht跥djV0Rjehu[ S+ d,-huj<臡hudh uZhFuPe[^]ÐUVS]U f;+Bw4ju_uauPhsuht_hSj4%FCf81wPjjhu[S:hu认t hu蝤19} HQPhu| C9|t hufVP[^]ÐUS]f;nuh=P0t$huht_hSjIB9EP0d=pCuh vΟSd]]ÐUWVS}] hv蠣h4v薣0Rhlv腣thvq hv]jhvL hv5f;4uEÞjC@PV(j:VLs_tVhv[ f;4tf?u!jhv0Rjfhv WV^hw谢Ohw衢h!w藢覞hJw舢[^_]ÐUWVS]}uf;u3E P衞VWEPEPCP.VWEPEPE P[ Se[^_]ÐUWVSUf:B f8MQhewEPq_UB f8ujPǃMQhhwWq_ Ur f>u{jjhvwPSV޿~w1t FO)ȃShwhq_hMQjAZQBWEP&VPURM QhwjjhwPSUR R-޿wDž1t FO)ȃ,t(Shxhvp_hURjAA} duhKxhoxR[^_]ÐUWVS}WRSRƃ u%Shxho_hWjK-$AhxFHPt%Shxho_hWjK@Shx觟e[^_]ÐU4WVS}uEEM URf?}t V-t}t臜EE G$ءءȞ(HGf8@PYPhxڞhxM Qn_jWR5V tOQ:&Ã}VR`ÃuWhx0jC'P QPU Rn_SjV QW?(&Rh y4Vh#yjS Q趷PU RDn_jVMQU RWoVMQU RWaVMQU RWh&yrjjVMQU RWh*yR nW Sh,y) t6hByVMQU RW PM Q[m_VU R>m_hEy՜=dt$hGyhl_hWj ==du$hxyhsl_hWj = @0Qhya@0P@0U Rl_dyM yQfyfQW93WyM yQWhy}tsM Q衫tZu ytFU Rhy]Sk_SMQ薚UR-hy胛hyM Qk_E URE̍e[^_]ÐUWVS1DžDž1DžDžUB2$آ(HhhxxDžTDž4#Džmhy!thy1Ʌt hzUZ f;u@ @0Qhzۙ@0P@0EPj_'jjURMQEPSt0jIjURRSPMQhzSUi_SVb$V蔖ƋUZf;u6 @0Qh%z1@0P@0Pni_jjEPURPSWVPV}jVVpP色PVi_ j]SSspPjPSh_jIjMIQc t,w% -zU 1zJSu'U RQVSURQ 5zM 9zQjIjMIQË, vEP覧tSh=zjIjURRphAz萗t hDzwShLzi8hQzRt hSzt h]z)Phhzt hlzhnz[^_]ÐUWVSUBjIjPPhpzuVf_,u{zt[MQU R诮tM QUR蛮u3M QURMQhzh1f_hURjBm a7zMzQdM Qmǃ)U Rhzhe_MQh7VS褽SVf_VWÃu9(0R 0QURhzhxe_hMQjG 6C'PURe_VW(t;MQ{~{Sh {he_hURj=XO6jEPWjPWŮPSPe_ SMQu0SURMQh1{hd_hURjG 5[^_]ÐUWVSMAf8tjHjPho{ojjURMQU RMI QUBPtq{M u{QMAf8U RkjHjMIQPhy{uVc_VS辿ǃ$u2(0R 0QVh{Sc_URSo4G'PM Qc_h{舓jHjURRh{n[^_]ÐUURU RURPh{=]ÐUVSu] f>uXtu]SvVmSh@nӺh@nvVlh@n]S谺UR|PS0P3t0SxP|PPTt1Ph@nb_$Vh{9Ph@nb_@np[^]ÐUWVS][|DžxDžpDžl5{5xnf;xt h{ّh{̑j艍h{軑jjhxn}W] S|vV$t0U D] ;TluKS%itP!l@tމpxd] Sh9tu؉pu VhP詺`dh9x~ Xh19d~F19h~3lD `9D upd B9hA9d|[ |xf;^lFp}8pPZ_Ph{>}Whxnj`_pl\ S_Ph{hxn__uVhxnuChxnP}W`_VPWh{h__ h]SjE0xnT[^_]ÐUEf8t1]ÐP1f:u R @f:t]ÐUU RURPh|]ÐUVS]f;uC {uB>KQ;UR@P̠ƃ uSh|l/e[^]Ð.A.U WVSnUс)$xذhx(8HXhد+|nB|E@P6E0ɋ}1tYEPEP襟ÃuURhV|B.Shn]_u}0щʃ9rhp|hnv]_E PURwEEEH xuQhr|URRXEEPUBRƃ uEPh|->LuVEP\_#]f|fUVS\_h|S\_EPh|$|9|)E@ 4Et<Eu$h|$h}hn[_'}1}9}>}E}|M}lT}\X}LURREPh]}hn)[_EPhb}ne[^_]ÐUWVS1jRU RNƉ >tX;:uKt,~ hx}ɊVbPh{}赊 U Rh~}螊:sGC;utVHbPh}ye[^_]ÐUWVSURMAf8%xA f8jURRڨ蹅h} xuh}h}މxtj菆jh}載t)j (0Q0Rjgh ~MA @ P#xtOj@h~mjjh~|PEPUB@ @@ P h$~7h'~*hV~ MAf8`諄hq~UBf8pffCfv}jjhx~|P]SV#޿~1t FO)ȃtLSh~hwX_hMA@PjA)h~Rh~E4UB@ P@˃h~ 跃h~ x7MA@ th~ۇhчphH‡(0R<P 0Qhr複tB@f8ujP6ajhphcjjh|P]StA@ P޿Džpp1t FO)ȃt+ShhV_htRj #(hنhʆh% ̂Wh@軂FhB蘆hD苆jHd[^_]ÐUVSu1ۋNf9%؉!tBf8tYB f8muЅuPhFt ffCfw؅uPhce[^]ÐUWVS]f;ugCE@PP_ƃtNV[S_11ۃ9]~+<v<v< wBC9]~t؅uVVL_11ۀ> t9]C<3 t3<v9]~ot<<3-u6{9}~.|-u'uj輁藀h1҉&<3 t3PhUĄU1C9]jlVK_e[^_]ÐUohoUR^o]ÐUURP]UE@@@ @@@@@ ƀ ǀ ǀ$ǀ(ǀ0ǀ4ǀ8ǀ<ǀ@ǀDǀ,ǀHǀLǀP]ÐUWM9t$0ҋ9thh `J_1}]ÐUWVS}u ]hɀVWLK_ 9w$غhHȻ(HXhȽCD `$XhxHK^KNK>K.KK@K D `8C tCC@CD `R PQ_C D `SD `RcD `SCDD `,/D ` D `RC_CD `$ǃ4D `Rj輺D `SD `*{$8(8ǃ<ǃHǃLǃPǃ@qǃDaD `(OH `e[^_]ÐUhkJ_·h(hWJ_h HJ_]ÐUhh `D_hh `D_hBh `D_hmh `D_ hh `oD_hh ``D_hh `QD_hh `BD_ h5h `0D_hTh `!D_hoh `D_hh `D_ hh `C_hтh `C_]ÐUWVSu~t!h|h |h| h3D0PC_~ hE|~tjhZ|V01ۃtG<:uhdt|Phn]|CV0щȃ9rhq5|e[^_]ÐUW=`?tS0`?Ѓ`?`?v`?/tJ`?v:/u:/uBRh`;L_h(hs`;}]UWVSR&ǃ~hD0R2B_19w~yf|w~kDwPMjPRÃtE0RSuK_t"SuShD0RA_ SDwPMF9whze[^_]ÐUWVSRSEx~,0RhD0RWA_hŃD0RFA_1Uf|zDzPNjPRƋR螴VRAÃutF0RSUJ_t2Spu%hCRSSPhD0R@_GU9zWD0ROyhyyh ytyh!yeyh7{yUz~0RhND0R@_e[^_]ÐU WVSRӦEh`yæEÃ޿ntm޿utZ޿|tGmtSE#P02PhxSRiSR輮hx }ahsxe[^_]ÐUU$((((((((]Ð]Ð]Ð]Ð]Ð]ÐRhY1]ÐUWS]01҃t*< v1 B0щȃ9rظe[_]ÐUWVEƿӄt&ƿۄtƿu 1e^_]ÐUE=t|!==|]Ð1]ÐUWVSDž|1ۋUR?tU R/u(U RURh]SF_URSuu Dž|>u"u Dž|u'u Dž|u .u@u 6u u ;u9|E Ep[^_]UVSRqphBut0RXPhmtp~uhtphVRht1ۃ9^~'T RɅuDžPh̅t C9^hхt"phمttcpph`topovVhHt7poh4th@u hHthO toohRsppohasohpse[^]ÐUVS1EPEPjR:,onht}s8s0RPhasEPEPFVR:tc~sh+sshs~rhsrVhr뎐rhr,nVhrxrhrhĆrNVhdžr19}XSShۆ}r 9|hjryne[^]UhOr0RRRhu3FX f;!ujSR n[ f;!tv f>t΃=,EumhZqDžlhʇ1q m1utZ,mlh߇ qltG~lQlhp Džtl=,Etlhqpuf>u-FX f;!ujSRl[ f;!tv f>tԃ=,Etkh p=,Eukh pUR]RhohEojU RhWo0Rh|o501t FO)ȃ$thoh|oh0RWhP5_$o0Rh3on0RRuPho=Cu7uf>u.FX f;!ujSRek[ f;!tv f>tԍShnWhS<5_ t ShݐhnR+j[^_]ÐUVSu0R'iShFniS0Rh*/njf>u-FX f;!ujSR)s[ f;!tv f>themR誗{ihgmi1ۃ 9^~N[iD 9t93t9u humT R<Phym C9^i ih\mkihMme[^]ÐUWVS]0R&hVhmh0RVhɉlhhVhl0D phVh lރf>u.FX f;!ujSRq[ f;!tv f>th~lR>hh!alPh1ۃ 9^~NgD 9t93t9u h/%lT RL;Ph= l C9^hghVkhYkgh[kghkk0R0%gVVhnk %gV0RVhk}g(gVh͊yk0DgVhڊTk fhBkfh3kBgh$$ke[^_]ÐUVSuf0Rg$PfSh'jjS0R# PhPjf>u*FX f;!uSRq[ f;!tv f>thjRDfhgjVf1ۃ 9^~LeD 9t93t9u h-jT RT9Phj C9^fehihiehiehie[^]ÐUWVS] }SkA$Shh `T0_Pƃ~p}tURh0W0_ h3W0_1ۃ9}9EPEPSUR0C99u7PURh<W/_ 9|hGW/_e[^_]ÐUWVShJhhbhhwhhhhh舊Ehh͌hdh،hEdUR_ËR!ESRhXhu 1t FO)ȃt[SURh!h EU9U|0Rh(hh7g0RhNgch_g}tnchwghge[^_]ÐUWVSEc9E}vUReËR E cSRhYgu1t FO)ȃtbUR[ShÍg E뉐h܍gbhfbH;Rh f|bh7fhJfhcfe[^_]ÐUS]ff]fvf;tf;uM=t=u[f;u C f8u(hYfdS dh=f]]ÐUWVS]h0ۘSӏa19whU RT R) ~a͎ÅtVT 00T Rl0C0P[,Seà tSS ^000U RT R˗t F9wfh0R蝘VhS+_t[h e`Shˎe VhS+_ tShΎdݐhюdRk`[^_]ÐUS]f;uSR[ S]]ÐUEf8u @ P ]ÐUWVSuM$hx8(d=d~$hh3_hVj h0gxjjh|P]SvV0P:._@0 SP3_h0xR薖h 2c^@0R@0SPh6 c VhS)_ tShDbݐhGbhJbxRd dzV RGv^vWVR'v f>ut"F f8u@P VRv Vl[^_]ÐUWVS1uf>jVRaSS.At8Ct3Ut.SShch1_hURjHjjhS=u.S趢Shhz1_hURjH趡Ov f>SER:NNjR1ۃ9^~-D 9t9t93t PMǃC9^Whauf>u]jVRASS=u/0RShɏh0_hURjHv f>tNh`Ee[^_]UM1wM$hBЉ]ÐIQh١d]ÐA wS$+((((((BI f9nuc~Ѓd~d]ÐUS=0tj=P;ua0R\hCR0Rj/h`?h ]S /_Sg1_ dCR0Rj/h`?hS._S>1_vZtZ|]ÐU=xCu h]ÐUjjj:URyPh._]ÐUWVSu]U RVz!u}tUR#NU RVY! {JNt Rh-ǃ{d{JFu#VWhhx-_CdPWh('{JAu*VWh2hx-_CdPWh<h-_Vhx._CdPh._&P{JFu VWhF{JAuVWhPhxa-_Vhx-_&x&xe[^_]ÐUX WVS] DžDžDž0RPX-_SV9-_S]S/-_ƅƅDžUUUf:4U$*u%jRRvPR,_Sj:7htRS#PRn,_]~ZB f8%ƅRR PRQPRRRRR7$R,3jRPu^zSj:ga*URSVj RV+_SURRG+_RVhcSv*_Vh}Sd*_(S32RUR*_ =0tVRgƃPURR*_RtjURRs PhP)_RUR*_$tEPn1RP)_0}ЃERRk'RhtPURRRhljRRrSRfÃ=0tSRfÃS&u?RPURShRc(_RUR(_ PR(_tARh͐0}ЃEP(_DžHt6RhԐ0}ЃEP'_Dž RPP(_RP'_RR'_f:j]SRqVRdSj:=ctSP#Sj:ctVSPURR'_!jVRpPUR/'_} u8t'hh&_hURj&Җt)~ RP$t UE[^_]ÐU WVSDžU$E( 0REPs&_Uf:4u tVEP-'URhS%_EPS腗UREP&_&0REP%_EX t2]t3[S蛡@UfDfBFB0ۋ} tU REP%_}щʃ}׾Gf}щȃE1PPwfÃuURhZ{SP$_0щʃщȃ9rftfU( =,0t3=dt*hvh#_hE@PjГ=80u<=<0u3=du*hhR#_hURRj苓9thȑURRj?bY E@P蚋PU$Rb#_u$ɑ1t FO)ȃ tVU$R|t@=80u7=<0u.E$PhБh"_hURRj˒E$PR"_E$PRO~Ã} tLP!P(0R0PU$Rhh"_hE@PJR4!P(0P0RE$PhDh!_hURRj?(dPU RP0RPRPUREP u$1t VO)ʃ$tVE$Pt@=80u7=<0u.U$Rhh!_hE@PjNE{YYuU$R0Phh `_S'REP;!_UR( }.P tURQ貕PEP _hSHR\U(} 0tU REP _SURE$PREP{KYu>Dž&RC'Ph}0щʃUR_T{[Yu:{HAu4&Ph}0щʃUR_ &PUR_hCHP[DE@ f8uwhUR_LËEPURE$PREP膌S0ɋ}щʃURBM$SLhEPW_ U$RPzU$RP貃荇t>{PU$REPhh_hURRj=ڎ h.EP_u11t VO)ʃuFf8Ef7{HCu%s':uhAEP`_tFhDURF_6E@ PURRE@PURhX蟏[^_]ÐUWVSDž}du$DžlDždL}eu*DžnDžd"DžpDžh0}WvIDžWU RL Q'u uƅT 00L QS>HSWhrL0F0Pv,V/Ãt*@PU RQ}WURSթSD}duGh#L000M Q| WV~t9QG}du d }eu dh0W~VhS_DžhlK GRhVKShՓKKVhS_ tShؓ*KݐFhۓ KhޓKQ~[^_]ÐUWVSuVj"VuVhx_1EE0Ѓ>"u|"ux"EHE9E})M9"t9\uƂx\BxAEB9E|܃}tƂx"BƂxxe[^_]ÐU WVS}u ]EPEPEPSV{tTURSVWÃURPPVShh_hWj}Yu+}Rt%VhTh\_hWj蛉V EtEPSVWFÃt3UR,PPVShh_hWjF$:e[^_]U WVS}M QUR}胁1f?U$f?X95]VU RMQJjPURHbPQ_W J QWPS_jSURbPS_ S 0Q_teRSX`ueQU RFPh"h `_h `Shch `_Qh 胉 Ff?Xu 99~Rheh `,f?Xt 1!Qhh `_[^_]ÐUWVShjhW _ƃu< `RWhJ VU RjUR+_V _hW _ƃuW_< `RWhV1V _W_؍e[^_]ÐUWVjjj:UR`PRSPh_ h$Vu(thh`_=%uX(0RRzEPEPh _P(0RR uEURh_e^_]ÐUWVS} ]E u(}$uX9EuSSURELO (0QR-LjFP 0QSWhjSMQKURN uhQNtetY O (0QRKjO u3 0QSWhUh_hURRj 6 0QSWhh_hURRj?蹄 1e[^_]ÐU.WVS] DžDžDžURS@,PURPJ!R6n?u h10щQ_SP_nÃ(0щQb_SPB_dnÃ_1ۃuX9}JtRPCu919~(R _P _C9ڃ8RRCSƅu hFS*FF*FO*FH*FW*FQ*V0щQ _PRA_F'0щQ _PR_0щQL _SP_$^d0щQ _SPBy_ 9l~MYbRP`GN1ۋ9+rut+PR+PR+Pjr+YP+YPREPRP0C9u1ۋ9+uut+PR+PR+Pju+YP+YPREPRP0C9u1ۃa9+ `Hts+PR+PR+PQ+YP+YPREPRPg0C9`1ۋ9+dut+PR+PR+Pjd+YP+YPREPRP0C9u19~CR_P_R_P_C9[^_]ÐUU RUR$%]ÐUVSuV%t$RV _t[4ut Ce[^]ÐUU RURp$t,fxx#t]Ð1]Ð]ÐUVSuVl#Ãt#V=1҅t {&tS&^Vh]S _S+#tL2VhS\ _S"u Px[^]ÐUVSu] SVn#u}tSV#t@1e[^]ÐUWVS}?%u\GP_ǃt#8%uf{Pu C9[4u߃9~1M QWf"Ãt[SMQ _FWhuV9 _V!Ãt"KQMQ _CaWhV _V!Ãu%13[SMQK _P[SMQ+ _St[^_]ÐUWVS}WU RkojWU Rh!]Su _S!t[UR@ P _u'VWURh)S> _S t,@ )FVWU Rh1S _롐1t[^_]ÐUSU RURh9]S _Sz u@|]ÐUSURh@]S _S. u @|]ÐUWVS}uVW.nEPEPSVW@t)URU R _uEC͐1e[^_]ÐUWVSu}URU RURhF]S_Snu 1P @t[^_]ÐUWVSu}U RURhN]Sp_Su1P@ t[^_]ÐUWVS}URhUEP_ UREPh[UR_uVÃtVE Phb*u j8_V|0щxQ_xVP_} t<} 0щxQQ_xCU RP_ C}t30ɋ}щxQ_xC URP{_C C0CC$C#fCC(fEfCM}fKC%C&C"C,fC fC|S4|l[^_]ÐUWVS} }}WURh|EPP_URWEPhUR1_uVÃtWhmsj8_V'|0щxQ_xVP@_}t?}0щxQ_xCURP _ C}t30ɋ}щxQF_xC URP_C C0CC$C#fCC(fEfCM}fKC%C&C"C,fC fC|S4|l[^_]ÐUVSuFP_Ãt58%u%fzPuB9uRRV_PR4u̓~1e[^]ÐUSURh]S,_StfxLu@1|]ÐUS]U RS?t x0t@0؋]]ÐUWVS} uUR[ÃtbS"S R_suU,s u U UC1e[^_]ÐUURu1]Ð@"]ÐU WVSURƃt;V R_U Rh]S_0P_F SP"_e[^_]UU RUR%]ÐUU RURpu 1]Ð@]ÐUWVSu}VÃu5VS%MS"Mf{%e[^_]ÐUUR ]Ðx,%]ÐUWVS]޿޿u7U RhǗ]S]_Stlx,%r;_u${Au{_u0=0Ѝ\SU R\ƃuU RSh˗n~QEt1t[^_]ÐUWVSuVh]S_S<V7xYEu=0=P@_áPS_ 1hSPVi @t[^_]UURhh_ht)PR@Phh_]Ð1]ÐUUR4tx%Y%]1]ÐUURt@%Y]Ð1]ÐUURt@ ]Ð1]ÐUWVS]} WƃtbFP5}Pu$APWhh_hSj2"APWh2h_hSj3nWhg]Sp_SƃtWhlkj84_Sl|0щxQ _xSP_}0щxQ_xFURPW_F0F FF$F#fFF(fEfFfUfVfFF%F&F"F,fF fEfF|V4|4l[^_]ÐUWVSjURE Pp tUR=pEt=ƅVH `PxuڍVRhtP_URtPputR|j8k_ËtxщpQG_ptRP_} xщpQ_pCU RP_C0C CC$C#fCfCfCC(C&FWC%fC fUfSFHC" ~QEuFtxщpQ_pC,tRP_ C,'pV:pfpfC|S4|81d[^_]ÐUWVS}  8-f{x*j:@P+_@P:t(UR@PPh* CPh*@Ph*hu*hɘk*ha*h$W* h-J*@PhG<*h2*h(*hڙ*h*[4e[^_]ÐUWVS} tC8+u3{&t-PjW@PPhURi_R%k[4u~e[^_]ÐUWVSURh]SJ_Sƃt} j8_S7|0P_SPZ_F F0fU fVF$F#fFfFF&F,FFMN"|V4|41p[^_]ÐUSURh]SL_St@&|]ÐUWVSuVh ]S _S‰t Bj8_Sh0щdQ_dSP_uV6dfdfBB$B#lVpPtVxP|V-|,:t;0щdQ_dB|VP}_@fxfpt5F%l5F'pEu 0Fp, @,l5F'h4p4h@ddX[^_]ÐU@']UVS] uMQ RR%e[^]ÐUURhg_hgh}hh)c@8tPh"_hf]ÐUWVS} CuURh9 MQh?EPf_ ]S ƃj8._Sf |0P _SP_F FFU V"F0F,| N4|41 p[^_]ÐUVS1ɺt8~u {"Uu[4u9~؅tRt98~u){"Ut#P:_~ [4uɃ~1e[^]ÐUWVSEPhC]S_S ƃj8_S |0щxQ_xSP _} 0щxQf_xFU RP_F FF0fEfFUV"F,|F4|41 l[^_]ÐUSURhG]S_S~ t @1|]ÐUWVS}WhKuV_j8{_V |0щxQQ_xVP_ U 0щxQ"_xCE PxW_U0щxQ_xCEPxW[_C C0C$C#fCC(fEfCfCfCC%C&C"}{,fC fC|C4|l[^_]ÐUWVS]DžxDžtSkbE  `BS]S_} l} dtR}} rt*} uuqEPpPSURS<pPSygE PSTSEP_UR|4PUR_pF9E u Džt~#~$t`fE fFU0:t@0ɋ}0щpQ_pF0U0RPX_F0w1t v4OxuTj8_ƍ]0Pt_SP_BF#fFfF fU fVDžxFPI_VR@_F P7_ 0ۋ}щpQ_pFURP|_}щpQ_pFURPN_}(щpQ_pF U(RP _$}0t?E08t7}0щpQl_pF0U0RP_ F0fEfFfFfFtV)fFfFF$F#fEfFU4V(E$F%fFF'U V"F&fE fF},Eu20ɋ}щpQ_pF,URP:_GEP-pu*URp~@,F,F,xu#fF |F4|41d[^_]ÐUWVSURQ<RURh_G9E ufGfG1U RF1ۃ9^~1T RUR tf@f@1HC9^ҋ4tRUR_xURhO"Z4De[^_]ÐUWVS1UR_NjRURt_C9E tS4V4S4R_{t SR_{ t S R_{0t S0R_{t SR_S}_ދ[4Ke[^_]ÐUj~6]ÐU=tj%]ÐUWVS19EtS4V4S4R_{t SR_{ t S R_{0t S0R_{t SR{_Sr_e`ދ[4V=e[^_]ÐUWVS7tgP_~t FP_~ t F P_~0t F0P_~t FP_^4V_ރu~e[^_]ÐUU RURt@#1]ÐUURt@$]ÐUVSuVrtRV_u [4u1e[^]ÐUWVSu} Vt'RV?_uC9t [4u1e[^_]ÐUWVSu} Vt'RV_uC9u [4u1e[^_]ÐUWVS}u W^t7RW_u C 9tC9u[4u1e[^_]ÐUSU1ɀ:t B:uȻXЋ]]ÐU=}]ÐUWVSEEE}<v :_{4C4PR_1. Q:WUj_UfzuPf{tPE}t@}tEhgU_UCPUP Qhj_Uf{uXz#uRtLfCf9FtB } C9u)PFPtfztCPBP;WCPBP QU Ut[4fzfztB9d:WJQU%UuruPzWhUU QBPKhkUrE躚E}M1t FO)ȃthU,U QzWhǚU Uz"Rtz"Fu*hΚUU QBPJhКhҚMf{t=E}t4}tEhך_CPP;Whښ_[4E}Ee[^_]ÐUWVS]tB9uz%Yt3R4u9~S=1ۃ9^~,| WtC9^1e[^_]ÐUWVSt_C9EuM{%YuGth_18#t8%u@Ph Ph%_[4u~h*n_e[^_]ÐUWVS1tmC9Eu[8-tT8~tO8+tJ8@tE8't@8#t;8&t68t,{"At {"Ct{"UuC"PCPSRRG[4u~e[^_]ÐUWVS11EU8~x{"At{"Ct {"Uth,j jh/@P_ ujI'jh5@Px_ ujH@PXP Z@P3t@FSRp!t@PSRh< @Pst@ NG[4E}e[^_]ÐUhVh^]ÐUWVSuj8_VE0щMQ_EVP5_U 0щMQ_ECE P}W_C$C#fCfCfCC(C0C CC"AC,C&fCC%fC EC4}e[^_]ÐUVSuVhf]S_Su jjV|x[^]UWVS1t`8+uP{"tJuhjURy_U R@PPhURW_@PhURE_F[4u~thUR_e[^_]ÐUWVS}tP8-u@f{~9x*t3j:@P[_u#@Pu@PPhW_[4u~hW_hW_8-f{x*tzj:@P_uj@POuZCPh̛W(_@PPh؛W_hW _$@Ph!W_@Ph:W_hbW_ [4_DhmW_e[^_]ÐUWVS}hqW_t_8-uOf{~Hx*tBj:@P_u2@P_u"CPhW8_@PhW)_[4u~hۜW _e[^_]ÐUWVSURhߜuV_Vxj8_V|0щxQ_xVP_} 0щxQr_xCU RP_fCC$C#fCfCC(C0C CC"C,C&fCC%fC |C4|l[^_]ÐUWVSMQhuV_V|j8_V|0P_VP_CfCC$C#fCfCC(C0C CC"C,C&fCC%fC |S4|p[^_]ÐUWVShUR_8<x_u'xAu!x_u0=0x1} t8@PhURf_ teWhURP_ QSR@PP0Rh%UR"_t!SR@PW0RhNUR_[47hwUR_e[^_]ÐUWVShyMQ_} t]8>uM@ƿt!PPhMQU^_PhםMQU>_ U[4u~hMQ_t#8>u@Ph!MQ_ [4u߃9~EM8>@ƿ:P@t?} t(R@PPRPhBMQb_LR@PP 0QRPhcMQ3_ hMQ"_hMQ_[4NE}-hMQ_e[^_]ÐUWVSUR.EURU R3à U 9URsV ǃU RVEjURU REPU RURURUR1^"Au{HAthОyC'PCQPWRW,RRGPhe_E,uWRtE1{QEtC'Pt9ut$h h_=CUz#t*{SNu$fufu?Wh(S(Y€{OY8u {OYuHfuAUfzuZfuPhh_ 1DURURURURh0P_e[^_]ÐU WVSEM{4 QC4P_utE1҉߾t< QQU_Uu$Ff{uKM [4uątfMfOfwt[4]E}?e[^_]ÐUS] MQ.19P~9\ uB9P1]]ÐUtRh]ÐU4Rhc]ÐURhH]ÐUEPh$]ÐU]ÐU]ÐU)]ÐU]ÐUWVS0ҋ}1t<];^u"PhnCF}0щȃ9rɍe[^_]ÐUVSu19}h"C9|e[^]ÐUS]SS_]]ÐUU]ÐU=u h R@=t h7<@ + ]ÐUE9u}RPhE? =uj]ÐUE Љ]ÐUSUM  9 v@B9 w  ]]ÐUE0U ]ÐUE0]ÐUS]<tRhj> RR_ ]]ÐUWVSu0} Љǃ94} Vhp> +  + ʋ I<  IJu    19}] E AB9|e[^_]ÐU0]ÐU0]ÐU WVS] uu4 +4u95u5UuRw_ǃuPhuFVRW_ E  94tR_<E8u>%`Fud?^$ {% ct;stKfx  CsV P_< 0щ΃4 CPh54 V_< 0щ΃4  Bsshssh P_< 0щ΃4 KI   IhE4 V _x I~a   I?EPhg:j_5u E Eu>g <u. U4V R _e[^_]UWVSj_Eؠ ujhܠ} 0ۋ}щMQ_E ؠ  M9u }щMQh } щMQT_E ؠ B Myu } щMQh }щMQ_E ؠ B Myu }щMQhc }щMQ_E ؠ B My u }щMQh uVؠ 0V_E P5ؠ4 FP_uVؠ pV_EP5ؠ4 F Pu_ؠe[^_]ÐUVS195ؠ~u ;t_8t P_xt @P_xt @P_x t @ P|_Rq_F95ؠؠe[^]ÐUؠ]ÐUE ]ÐUWVS]} 90uW,Rc_u0,WhQ_WSUttU'PS"1ۃ9^~4WT Rtt'PC9^΃= u h4e[^_]ÐUWVSM 0,M Qh_1ۃ9 ~C08tMQPM QMQUUC9 e[^_]ÐUWS]j_ ujh< 0щMQP_E  M9u0щMQhGS P_ e[_]ÐUVS195 ~9;t#8t PĽ_R蹽_F95  e[^]ÐU ]ÐUE]ÐUWVS195 ~rPMQ_t-PNjMQP1҃ 9P~$9| u#B9PރF95 1e[^_]ÐU WVSEEE9 ~M80щMQw_ERPE_ EE9 E$e[^_]ÐUVS19$~P _C9$e[^]ÐUWVS 9$t1EM9 EM0R19$~qQMP_tR}t@Q7ƋMP(P*1҃ 9P~9p tB9P~9t u9Pu C9$9$+EEM9 Ee[^_]ÐUWS] EE0҉߈1҃t2E8u#B0щȃ9r1e[_]ÐUWVS1EPÃu 0DShE Phd_Sƒ~pFÅt0u19}+] SpPNlmG9|1`[^_]ÐUVSu] V-tShV؍e[^]ÐUWVSu ujEPj:UR Ãtv;td;tC;>uPVUR>C !SUR,uPVQ_0Ѓ:Ft ;p9utFe[^_]ÐUVSjURRY PRƋRVe&=1t1RVG;ue[^]ÐUVSjURR ƋRV'=1t1RV;ue[^]ÐUWVEƿ&trƿ. t_ƿ8tLƿ@t9ƿEt&ƿLtƿPu1e^_]ÐUWVS}XtRW[_u 9v1e[^_]ÐUWVS}СRW _u 9v1e[^_]ÐUWVSuXtRV軿_t$9vСRV藿_u 9v1e[^_]ÐUWVS}1۾XRWO_uCv׸e[^_]ÐU]ÐUS]| 9|hUhAhuhKX]]ÐUU RURh+]ÐUWVSu01ۃt/>t>/uD+uV莬_w90~,Vv_Ph h0n_CM 10e[^_]ÐUWVSEEEu0ҋ}1ۃtEEPEP%ƒtEPRV_ u]}0щȃ9rEe[^_]UWVSM QMQ_u uM Q2MQGÃt.M Q5ƒt9M Qj:5u }G?t?:uM F>t>:uM QMQMt}OMNM >t?u>%\SMQWÃMQh$$S?ËM Q,19S~ 9D tB9S1e[^_]ÐUVSu] ;%u SZ;*uBCPVuDWj'PVPhDA_6}u:1Ҁ;:t;t؊D@B8:t8uƂDD ؍e[^]ÐUWVS]}uM M1҉؀;t,8 tģ@B8tM8u8t tƂģt8uDģe[^_]ÐUWVS]} ?*t\0PW(_EtFjh@Wa_ t2jWSyƃ t 0҉t V7PS(e[^_]ÐUWVS}U R.V^~/Åt!CPW菴_u7VRtPWÃu u1e[^_]ÐUU RUR`t ]Ð1]ÐUWVS]} j/W\_uj/WM_txWS_0Ѓ~+؉ƿEtƿHuS$e[^_]ÐU=Lu!L%LH LL]ÐUVS]u VSu CftCCe[^]ÐUE@]ÐUUR$@]ÐUEU DP]ÐUVS] uV1Ƀ9H~TH9u R5A9H1e[^]ÐUSM] 19Q~%DQ9uB9Q1]]ÐUWVS} URN1ۃ9^~8D^PWP_ uD^C9^1e[^_]ÐUWVS]S EESPz1 M9y~ZUT Rƃt&19^~3D^PMQ C9^UT RMQGU9zEe[^_]ÐUVSuU R7t#PeSV uSVՐe[^]ÐUM9t 9~1]ÐUS;u Se9~hL]]UWVSu19~)D@PV(_%C9j蒪_Dujh"0ۉщMQV_E DB DMyuщMQh } щMQ_E D DM9u } щMQhhVDBP&_U RDR_e[^_]ÐUVS195~MD;t7xt @PN_8t P<_R1_F95e[^]ÐU]ÐUED]ÐUWVS= ul URǃԥ9>u$RUR_uv1e[^_]ÐUWVSԥR 9ve[^_]ÐUWVSu101ۃt!2B0щȃ9r؍e[^_]ÐUWVS}1=$t%1ې,RW_t F$uߍv$$t#TM TMD6hh `5_h `W:_hh `_1e[^_]ÐUWVSM]1҃=$t9 $t$B8t9uR$$u 1;|u >|u>u Dt D D e[^_]ÐUWVS]u }SISEP; Ht-IuZff2ff0}1ۃt1ɀ=Lt2L8D+tLA?t8D+uLuT+tƅuPPhV芪_ Vh̪_C0}Ѓ9ph[^_]ÐUE4|$ccccccccccccccccccccc]ÐE ]Ð1]ÐUE==| ]Ð1]ÐUVSu1Vu jVt؍e[^]ÐU WVSE} 8@t8#t 8|t8&u 1P]SSH%؉ƃ v$t(Ð,REP_t F$u܍v$uDHtj$P-$P%e[^_]UUE 8t8\u@ B@8u]ÐUUE 8t8\u\B @B8u]ÐUVS]u VSuCt CUCe[^]ÐUE@]ÐUUR@]ÐUUE D ]ÐUS] MQ@1҃9P~9\ uS( B9P1]]ÐUUM =u$19B~9L u]Ð@9B1]ÐUWVS} UR1ۃ9^~8T RWP_ uD C9^1e[^_]ÐUUR]ÐUWVS]Sǃ<ljSWEM9O~kUT Rƃt619^~@QT RW C9^ML QW"EU9We[^_]ÐUWVSu} WtGP~:WPVR 7t#PSV uWSѐe[^_]ÐUM1Ҹ9t ,B ~1]ÐUS1;uS <,@ ~=t1,|uh]]ÐUS]K?19S~4| t&9t"D 9D u9uD B9SIy‹]]ÐU WVS}u }W j} Wh$RjS 'PR @d JffP @[N Hf=f8U9a} WÃ{ jWh$e[^]ÐUS]hj]]ÐUVSU4T3R_D3e[^]ÐU=c$]Ð]Ð11҃t@c~]ÐUWVSEM QMQM QMQiǃu>*u ! f %fK>:u+t,C r[CZ>>uPSUu0Ѓ>U~t,C  CF>Mt]Ce[^_]UWVSu} EPEPSCVu1WUR_uӋEe[^_]ÐUVSuVʋÃuiVujjjV1L1ې…t!CSB'PBPVPjjVɌ؍e[^]ÐUS] U(h,S虋_u Sh.]]ÐUR݊_]ÐUSMU =u$Ly||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||R#ffȋ]]UWVS}u Džfflfv f>thSjrhh^==~=F f8}t~hUR._RSR0}ЃEP[ 뵐e[^_]ÐUVS]u f;t0f;t)f;Jt#f;thhhh =t= JtVt=t)=ubhCP'nh[SMSPhC_ *Sh';Zuh16u hh|tุe[^]ÐUW}ff fv"f?Jth<h?hhڙ=tJt =ubG+Wh>P:Ph_0ƀ}]ÐUVSufffvhh[hhHtIuV RÃ"Vh/S*PSe[^]ÐUVSUu :@t]:#tX:&tS:|tNEPEPRà }u8Iu0Ph_Shш_!VEPRPhΈ_e[^]ÐU WVSMfffvhAhhsh|8MHtIu4A PMI Qƃ#EPhXMf9IuRhh8苇_087E] >t7EPVEuPS轇_0҉ЃÃ>uʻ8=8;\uc{t{\tGS `Pu8KQj\hh8_EPh8XNCA `Pu&Rhh8薆_MQh8dWC;ZEPMQ:Et9Ef8IuRhh89_MQh8nWh h8d_8e[^_]ÐUWVSUB$܇ ,<Ll|̉܉L<    ܈ RR"01ۃtE 3 uƂ\BƂnBC0щȃ9rƂ"ƂQE PR6EE3R Rh jRPhrr h hO_$.6;~BqJaQQUARRGPhZPh_h葃_e[^_]ÐUhUR臍]ÐUVS]1C9CwSvv_tCC@3tF͐e[^]ÐUVSu1ۍEPh|Vy_ 9]v:F9FwVv_tFF@3C9]wƃ@3e[^]ÐUjf]ÐUWVS5f=uE BffBfHf#Bff9vff9~hP賆P)׉PPe[^_]ÐUSf]9w5EffBЋ]]UUfE 1Ʌtf9r%ff9Eȉȉ]ÐU9wffBMJЉ]ÐU9wzffBMJЉ]ÐU9w:ffBMJЉ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJM JMJ MJMJMJM JM$J M(J$M,J(M0J,Љ]ÐU9w*ffBMJЉ]ÐU9wffBMJЉ]ÐU9wffBMJM JЉ]ÐU9wZf fBMJЉ]ÐU9wf fBMJЉ]ÐU9wf fBMJM JMJ Љ]ÐU9wf fBMJЉ]ÐU9wJf fBMJЉ]ÐU9w ffBMJM JMJ Љ]ÐU9wffBMJЉ]ÐU9wzffBMJM JMJ Љ]ÐU9w*ffBMJM JЉ]ÐU9wffBMJЉ]ÐU9wffBMJЉ]ÐU9wZffBMJM JЉ]ÐU9w ffBMJM JЉ]ÐU9wffBMJM JЉ]ÐU9wjffBMJЉ]ÐU9w*ffBMJЉ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJM JMJ Љ]ÐU9wJffBMJЉ]ÐU9w ffBMJЉ]ÐU9wffBMJЉ]ÐU9wffBMJM JЉ]ÐU9w:ffBMJЉ]ÐU9wf fBMJЉ]ÐU9wf!fBMJM JMJ Љ]ÐU9wjf"fBMJM JMJ Љ]ÐU9wf#fBMJM JMJ MJMJЉ]ÐU9wf$fBMJЉ]ÐU9wzf%fBMJЉ]ÐU9w:f&fBMJM JЉ]ÐU9wf'fBMJЉ]ÐU9wf(fBMJM JMJ MJMJMJM JЉ]U9wJf)fBMJЉ]ÐU9w f*fBMJЉ]ÐU9wf+fBMJM JЉ]ÐU9wzf,fBMJЉ]ÐU9w:f-fBMJЉ]ÐU9wf.fBMJM JЉ]ÐU9wf/fBMJЉ]ÐU9wjf0fBMJЉ]ÐU9w*f1fBMJM JMJ Љ]ÐU9wf2fBMJЉ]ÐU9wf3fBMJЉ]ÐU9wZf4fBMJM JMJ Љ]ÐU9w f5fBMJM JMJ Љ]ÐU9wf6fBMJЉ]ÐU9wzf7fBMJЉ]ÐU9w:f8fBMJM JMJ MJMJMJЉ]ÐU9wf9fBMJЉ]ÐU9w f:fBMJЉ]ÐU9wZ f;fBMJM JMJ Љ]ÐU9w f<fBMJM JMJ Љ]ÐU9wf=fBMJЉ]ÐU9wzf>fBMJЉ]ÐU9w:f?fBMJM JMJ Љ]ÐU9wf@fBMJM JMJ Љ]ÐU9wfAfBMJЉ]ÐU9wZfBfBMJЉ]ÐU9wfCfBMJM JMJ MJЉ]ÐU9wfDfBMJM JЉ]ÐU9wz fEfBMJM JMJ Љ]ÐU9w*"fFfBMJM JMJ Љ]ÐU9w$fGfBMJM JЉ]ÐU9w&fHfBMJM JMJ Љ]ÐU9w:(fIfBMJM JMJ Љ]ÐU9w*fJfBMJM JЉ]ÐU9w,fKfBMJЉ]ÐU9wZ.fLfBMJЉ]ÐU9w0fMfBMJM JMJ Љ]ÐU9w2fNfBMJM JMJ Љ]ÐU9wz4fOfBMJЉ]ÐU9w:6fPfBMJЉ]ÐU9w8fQfBMJЉ]ÐU9w:fRfBMJM JMJ Љ]ÐU9wj<fSfBMJЉ]ÐU9w*>fTfBMJЉ]ÐU9w@fUfBMJM JЉ]ÐU9wBfVfBMJЉ]ÐU9wZDfWfBMJЉ]ÐU9wFfXfBMJM JMJ Љ]ÐU9wHfYfBMJЉ]ÐU9wJfZfBMJЉ]ÐU9wJLf[fBMJЉ]ÐU9w Nf\fBMJЉ]ÐU9wPf]fBMJM JЉ]ÐU9wzRf^fBMJM JЉ]ÐU9w*Tf_fBMJM JMJ Љ]ÐU9wVf`fBMJЉ]ÐU9wXfafBMJM JMJ Љ]ÐU9wJZfbfBMJЉ]ÐU9w \fcfBMJЉ]ÐU9w^fdfBMJM JЉ]ÐU9wz`fefBMJЉ]ÐU9w:bfffBMJЉ]ÐU9wdfgfBMJM JMJ Љ]ÐU9wffhfBMJM JMJ Љ]ÐU9wZhfifBMJЉ]ÐU9wjfjfBMJЉ]ÐU9wlfkfBMJM JЉ]ÐU9wnflfBMJЉ]ÐU9wJpfmfBMJЉ]ÐU9w rfnfBMJM JMJ Љ]ÐU9wtfofBMJЉ]ÐU9wzvfpfBMJЉ]ÐU9w:xfqfBMJM JMJ Љ]ÐU9wzfrfBMJM JMJ Љ]ÐU9w|fsfBMJЉ]ÐU9wZ~ftfBMJЉ]ÐU9wfufBMJM JMJ Љ]ÐU9wfvfBMJЉ]ÐU9wfwfBMJЉ]ÐU9wJfxfBMJM JMJ Љ]ÐU9wfyfBMJЉ]ÐU9wfzfBMJЉ]ÐU9wzf{fBMJM JMJ Љ]ÐU9w*f|fBMJЉ]ÐU9wf}fBMJM JMJ Љ]ÐU9wf~fBMJM JЉ]ÐU9wJffBMJM JЉ]ÐU9wffBMJЉ]ÐU9wffBMJЉ]ÐU9wzffBMJM JMJ MJЉ]ÐU9w*ffBMJM JЉ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJM JMJ Љ]ÐU9w:ffBMJM JMJ Љ]ÐU9wffBMJM JMJ MJЉ]ÐU9wffBMJM JMJ MJMJЉ]ÐU9w:ffBMJM JЉ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJЉ]ÐU9wZffBMJЉ]ÐU9wffBMJЉ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJЉ]ÐU9wJffBMJЉ]ÐU9w ffBMJM JMJ Љ]ÐU9wffBMJЉ]ÐU9wzffBMJЉ]ÐU9w:ffBMJM JMJ Љ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJM JЉ]ÐU9wJffBMJM JЉ]ÐU9wffBMJM JЉ]ÐU9wffBMJЉ]ÐU9wjffBMJЉ]ÐU9w*ffBMJM JЉ]ÐU9wffBMJЉ]ÐU9wffBMJЉ]ÐU9wZffBMJM JMJ Љ]ÐU9w ffBMJЉ]ÐU9wffBMJM JЉ]ÐU9wzffBMJM JЉ]ÐU9w*ffBMJЉ]ÐU9wffBMJM JЉ]ÐU9wffBMJM JЉ]ÐU9wJffBMJЉ]ÐU9w ffBMJЉ]ÐU9wffBMJM JMJ Љ]ÐU9wzffBMJЉ]ÐU9w:ffBMJЉ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJЉ]ÐU9wjffBMJЉ]ÐU9w*ffBMJM JMJ Љ]ÐU9wffBMJЉ]ÐU9wffBMJЉ]ÐU9wZffBMJM JMJ Љ]ÐU9w ffBMJЉ]ÐU9wffBMJЉ]ÐU9wffBMJM JMJ Љ]ÐU9w:ffBMJЉ]ÐU9wffBMJЉ]ÐU9wffBMJM JЉ]ÐU9wjffBMJЉ]ÐU9w*ffBMJЉ]ÐU9wffBMJM JMJ Љ]ÐU9w ffBMJЉ]ÐU9wZ ffBMJM JЉ]ÐU9w ffBMJЉ]ÐU9wffBMJЉ]ÐU9wffBMJM JЉ]ÐU9w:ffBMJM JЉ]ÐU9wffBMJM JMJ Љ]ÐU9wffBMJM JMJ MJЉ]ÐU9wJffBMJM JMJ Љ]ÐU9wffBMJM JЉ]ÐU9wffBMJM JЉ]ÐU9wZ ffBMJM JЉ]ÐU9w "ffBMJM JЉ]ÐU9w$ffBMJЉ]ÐU9wz&ffBMJЉ]ÐU9w:(ffBMJЉ]ÐU9w*ffBMJЉ]ÐU9w,ffBMJЉ]ÐU9wz.ffBMJM JЉ]ÐU9w*0ffBMJЉ]ÐU9w2ffBMJЉ]ÐU9w4ffBMJЉ]ÐU9wj6ffBMJЉ]ÐU9w*8ffBMJЉ]ÐU9w:ffBMJЉ]ÐU9w<ffBMJЉ]ÐU9wj>ffBMJЉ]ÐU9w*@ffBMJЉ]ÐU9wBffBMJЉ]ÐU9wDffBMJЉ]ÐU9wjFffBMJЉ]ÐU9w*HffBMJЉ]ÐU9wJffBMJЉ]ÐU9wLffBMJЉ]ÐU9wjNffBMJЉ]ÐU9w*PffBMJЉ]ÐU9wRffBMJЉ]ÐU9wTffBMJЉ]ÐU9wjVffBMJЉ]ÐU9w*XffBMJЉ]ÐU9wZffBMJM JMJ Љ]ÐU9w蚿\ffBMJM JMJ Љ]ÐU9wJ^ffBMJЉ]ÐU9w `ffBMJЉ]ÐU9wʾbffBMJM JЉ]ÐU9wzdffBMJЉ]ÐU9w:fffBMJЉ]ÐU9whffBMJM JMJ Љ]ÐUS9w詽jffB]ZM JM]J ZЋ]]ÐU9wJlffBMJЉ]ÐU9w nffBMJЉ]ÐU9wʼpffBMJЉ]ÐU9w芼rffBMJЉ]ÐU9wJtffBMJЉ]ÐU9w vffBMJЉ]ÐU9wʻxffBMJЉ]ÐU9w芻zffBMJЉ]ÐU9wJ|ffBMJM JЉ]ÐU9w~ffBMJM JЉ]ÐU9w誺ffBMJЉ]ÐU9wjffBMJЉ]ÐU9w*ffBMJЉ]ÐU9wffBMJЉ]ÐU9w誹ffBMJЉ]ÐUSf] 9weffBMJfZЋ]]ÐU9wffBMJЉ]ÐU9wڸffBMJЉ]ÐU9w蚸ffBMJM JЉ]ÐUS]0fCf{!H=$xHx[0SRS RSRSRSRSRS RS$R S(R[,SRS RSRSRSR[SRwS RnSReSR\[YSRGS R>SR5[ 2[ SRS R[[SR[ ]]ÐUS]9L|(9u %J@9L}LL9ujhh=LL]]ÐUȮRU RjURO,_]ÐUSSEPAShȮR+_]ÐUS]u4ȮP9Pwh''f{uYȮP9PwhP9'_@Sfjhc'f{vYȮP9PwhP&_@SDfjhjS|f;vIȮP9PwhPy&_@jSb4ȮB9BwPR0&_ BfCH=j&$(Hh(Hh(Hh(Hhh(Hh(H8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx(Hh(Hh(Hh(Hh(Hh(Hh(HhHh8Xx8Xx8Xx8XxHh8Xx8xHh[`CPCPh!CPCPh!CPCPhCPCPh ȮQe%_KQK QKQKQ KQKQK QK$QK(Q[,~CPCPh CPCPh CPCPh ȮQ$_h@3[S7h@3h ȮQ$_ȮP9P CPCPh; CPCPh CPCPh+CPCPhCPCPh CPCPh)CPCPh2{CPCPh;CPCPhDCPCPhMCPCPhVCPCPh_;CPCPhhCPCPhqCPCPhz{CPCPh[CPCPhkCPCPhKCPCPhCPCPhCPCPhCPCPhCPCPh{CPCPh[CPCPhkCPCPhKCPCPh+ CPCPhCPCPhCPCPhCPCPh {CPCPh ȮQe _KQK QKQKQ KQ[CPCPhCPCPh%CPCPh.CPCPh7CPCPh@{CPCPhICPCPhR;CPCPh[CPCPhd+CPCPhmCPCPhvCPCPhCPCPhCPCPh[CPCPh;CPCPh ȮQ%_KQK QKQzKQq[ nCPCPhCPCPhCPCPhCPCPhCPCPhKCPCPh+CPCPh;CPCPhCPCPhCPCPhCPCPh+CPCPhCPCPh{CPCPh![CPCPh*kCPCPh3CPCPh<CPCPhE ȮQ_h@3[S.h@3hN CPCPhQkCPCPhZKCPCPhc[CPCPhl;CPCPhuCPCPh~CPCPhCPCPhCPCPhkCPCPhKCPCPhCPCPh CPCPhCPCPhCPCPhCPCPhCPCPhkCPCPhKCPCPh CPCPhk CPCPhCPCPhCPCPhCPCPh CPCPh)kCPCPh2 CPCPh;+CPCPhD CPCPhMCPCPhVCPCPh_CPCPhhCPCPhq CPCPhzKCPCPh+CPCPh;CPCPhCPCPhCPCPhCPCPhCPCPhkCPCPhKCPCPh[CPCPh CPCPhCPCPh CPCPhCPCPhCPCPh CPCPh KCPCPh[ CPCPhk CPCPh%K CPCPh.CPCPh7CPCPh@+CPCPhICPCPhR{ CPCPh[[ CPCPhd; CPCPhmCPCPhv ȮQ_KQCPCPhCPCPh ȮQ _[CPCPhkCPCPhKCPCPh+CPCPh CPCPhCPCPh ȮQ _h@3[Sh@3h+CPCPhCPCPhkCPCPhKCPCPh +CPCPh  CPCPh CPCPh CPCPh% CPCPh. CPCPh7 kCPCPh@ KCPCPhI +CPCPhR  CPCPh[ CPCPhd CPCPhm CPCPhv CPCPh kCPCPh KCPCPh +CPCPh  CPCPh CPCPh  ȮQ_KQ<[ 9CPCPh CPCPh {CPCPh  ȮQe_h@3[Sh@3h CPCPh CPCPh CPCPh  ȮQ_jCPj.CPCPh  ȮQ_jCPjC PCPCPh kCPCPh KCPCPh +CPCPh  CPCPh CPCPh$ CPCPh- CPCPh6 CPCPh?  ȮQu_h@3[Sh@3hH CPCPhK  ȮQ5_h@3[Ssh@3hT CPCPhW CPCPh` CPCPhi CPCPhr CPCPh{ nCPCPh  ȮQU_CP{CPCPh CPCPh  ȮQ_iCPCPh  ȮQ_h@3[S#h@3h  ȮQ_ȮP9PwjP_@]]ÐUS] EȮff=u LSSf ]]ÐUȮRU RjUR?_]ÐUWVSuSh ȮR)_0ЃPSf[^_]ÐUWVS]ȮB9BwR_tȮPf@ fĮ==t-=tY=t"&jh]&jhjhĮĮPPSf9tYh `h _Ѓ>jhĮDĮPLj ĮP賈ĮH=%$HHXxHh ( H h      ( H h      ( H h      ( H h    8 X x     8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xx8Xxh(Hh(HhHh(Hh(Hh(Hh ( H h    !(!H!x!!!!!"8"X"x"""""#8#X#x#####$8$X$x$$$$$8%X%x%%%%&H&h&&&&&'('H'h'''''(((X(x((PPh !PPh  PPh [PPh 5ȮV_P PPP PP P$P(P,PPh + PPh  PPh  PPh PPh PPh#  PPh- kPPh7 KPPhA PPhK  PPhU kPPh_ PPhi PPhs PPh} ;PPh PPh PPh  PPh PPh KPPh +PPh PPh kPPh KPPh PPh  PPh PPh KPPh +PPh + PPh kPPh' KPPh1 PPh;  PPhE 5ȮV_P P PP PPPhO {PPhY [PPhc  PPhm PPhw PPh PPh PPh PPh PPh [PPh ;PPh PPh {PPh PPh PPh 5ȮV_P PPP PPh ;PPh PPh {PPh [PPh PPh! PPh+ PPh5 PPh? ;PPhI PPhS  PPh] PPhg ;PPhq PPh{ KPPh PPh PPh ;PPh PPh PPh ;PPh PPh {PPh [PPh ;PPh PPh PPh PPhPPhPPh{PPh%PPh/;PPh9PPhCPPhMPPhW PPhak PPhkPPhu[PPhPPhPPhPPh PPhPPhPPhPPhPPh;PPhPPh PPhPPhPPhPPh {PPh[PPhPPh)PPh3PPh=PPhG;PPhQPPh[{PPhe PPho;PPhyPPh{ PPhPPh; PPhk PPhK PPh[PPh;PPh+PPhPPh[ PPh; PPh PPhPPh5ȮV_P P}PrqPPhPPhk PPh#PPh-PPh7PPhA PPhKKPPhU+PPh_ PPhi PPhs PPh}+ PPh PPh;PPhPPhPPh PPh PPhPPh PPh PPh5ȮV_jP PPh+ PPhPPhPPh  PPh{PPh[PPh'k PPh1K PPh;PPhE PPhO PPhYKPPhc PPhm PPhwPPhK PPh+ PPhPPh PPh PPh+PPh PPhk PPhPPh+ PPh PPhkPPhPPh{PPh PPhkPPh!PPh+PPh5PPh?5ȮV_P P  PPhI+PPhS^PPh]>PPhgPPhq5ȮVS_bPPh{PPhPPhPPhPPh{PPh{PPh;PPhPPhPPhPPhPPhPPh{PPh[PPh;PPhPPhPPh%PPh/PPh9PPhC{PPhM[PPhW;PPhaPPhkPPhuPPhPPhPPh5ȮV_P PPh;PPhPPhPPhPPhPPh5ȮV_jPFj.PPh5ȮV_jPj P PPh+PPh PPhPPhPPh PPhPPhkPPh)KPPh3KPPh=+PPhGPPhQPPh[PPhePPhonPPhy5ȮVs_PPPhPPh5ȮV#_PPPh5ȮV_5ȮVa0@3ЃPh@3Be[^_]ÐUUȮff=u LEPf E]ÐUS] H= $x)-@6@66(-@6@6@6@6@66@6@66@66H.@6@6h...@6@666@6@6@6.@6@666.@6@6X/@6x/@6@6(0@6@6H0@6@66@6@666@6@6h0@6@666@6@666@6@60H166h166@6@6@666@6@6@66@6@61@6@66@6@6@6@6116@66@6@61@6@666@6@62@6@66@6@666@6@66@6@66@6@66@66(2H2@6@6h226662(336@6@6@66@6@66@6@666333@6@64@6@6$6@684X4@6x44@6@66@6@66@6@66@6@66@6@66@6@64@6@66@64@6@64568565555@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@6@666SPC SPCPRS PC PRSPCPRSPCPRSPCPRSPCPRxS PC PR\S$PC$PR@S(PC( PR!S,PC,SPCSPCSPCSPCwSPCWSPCPRDS PC PR(SPCPR SPCSPCSPCPRS PC PRSPCPR|SPCPR`SPCPRDSPCSPCSPCSPCPRS PC PRSPCPRSPCPRpSPCGSPCPR4S PC PRSPCSPCSPCSPCSPCwSPCWSPC7SPCSPCSPCSPCPRS PC PRSPCSPCgSPCPRTS PC PR8SPCSPCPRS PC PRSPCPRSPCSPCSPCgSPCGSPC'SPCSPCSPCSPCSPCSPCgSPCGSPC'SPCSPCPRS PC PRSPCSPCSPCzSPCZSPC:SPCPR$S PC PRfK]]ÐUS]ScS]]ÐU]ÐU]ÐUWS]=thjShh1} tP裓}tc0ЃP_j/ShW_jWa_t"Whh `j_Wr_S葊}%Sh zh4h&P uh.hhNR芋 uhWYh,hxRZ uh)h0hR* uhhhR uhhhRʊ  uhh0h(R蚊 uh1lhxhRRj uh]R:u4uCjRevu.,RjR9x|,1e[^]ÐU =Huh4RtH4UUU UUUUUjEPhLjEPhQjEPh_jEPhhRct4t 1]ÐjRuuߋHRjRVw|H]Ð1]ÐUh,jRx tPhph `+_]ÐUS]8jCPh@[kjC'P'PGk KHHH@I Qt/} It @[C[SR Qwu 1 ]]ÐUURj Rwu1]Ð]ÐU S]USUSHUS'UjEPhjEPhjEPhjEPhRwr4uSR]܉]ÐUS] UUjEPhR)rumjRTsu]h,jR)u uBS0R"uh,jRv thh ` _]]ÐUWVSu}]jM Qh4=ijShS0itlujVhiURH0=,srzyw w wv|{~}N$hh=h,|1 e[^_]ÐUVS]uxUjU RhgjVhgSt@H|hxe[^]ÐUxUxjU RhgEUjEPhjEPhRo(t]ÐjRpu 1]Ðu ]Ð]ÐUhxjRZr|x]Ð1]ÐUS]= uh< Qn <  KHjCP PkfjC'P 'PWf Q_}tA uSR Qsu1]]ÐUS]USUjEPhjPhjEPhRm(uSRM]]ÐUS] UUjEPh(RmumjRnu]hxjRp uBS|RuhxjRq th1h `}_]]ÐUhxjRq tPhRh `;_]ÐUS]jU RhodS=uShh `_@HPh"]]ÐUEEjEPhR>lt]ÐjRRmu 1]Ðu ]Ð]ÐUhjRn|]Ð1]ÐUhjRJp tPhh `˪_]ÐUWVSu>hhhh^uh7hhUh`f0uh~hhh9 jShb Q{t3}]t M 9H$t& M N$VR Q'ou1e[^_]ÐUS]SUUjEPhjEPhR juSRe]]ÐUS] UUjEPhRiumjRju]hjRl uBSR!uhjRn thh `蝨_]]ÐUE00EjEPhRht]ÐjRju 1]Ðu ]Ð]ÐUh0jRk|0]Ð1]ÐUSE]0@H4jU Rh8_jShW_h0]]ÐUS]=uh QgjCPP_ Pt}At SR QClu1]]ÐUU UUUjEPhjEPh!R,gt1]ÐhRou ]Ð1]ÐUS]SUUjEPh/jEPh8RfuSR]]ÐUh0jR*k tPhFh `諥_]ÐUS] UUjEPhsRfumjRDgu]h0jRi uBS4Ruh0jR{j th|h `_]]ÐUWVS}]u=0jU Rh8']jShW]jVhv ]U$WuWhh `耤_@H4h0e[^_]ÐU0U0jU Rh8\EUjEPhjEPhRd(t]ÐjReu 1]Ðu ]Ð]ÐUh0jRZg|0]Ð1]ÐUS]=uh@ Qc@ KHjCPPk[jC'P'PW[ Q_}tA uSR Qhu1]]ÐUS]USUS'UjEPhjEPhjEPhRb(uSRD]]ÐUUUU UUUjEPhjEPhjEPhR{b(t1]ÐhR u ]Ð1]ÐUS] UUjEPhR bumjR4cu]h0jR e uBS4Rquh0jRkf th!h `_]]ÐUh0jR*f tPhBh `諠_]ÐUS]=tuh Q`tt K'H't@(tK)H)t@*jCPtPXC0PK,Qt,P+tKHPZ}t< uSR Q3eu1]]ÐUS]US'USUjEPhxjEPhjEPhR`(uSRd ]]ÐUWVSu }]UURh誨_jVh\WWURh URu.URhh `Þ_h /@Hhh ؍e[^_]ÐUS]UjU RhVSh_UEEjEPhjEPhjEPhR^tfFQ֏_~af^P謓_‰u)FPh h `}_fF9FPM QR詓_fFe[^]ÐUWVS}1G(9p~91ېU R@DP臘_uG(@DFG(9p̸e[^_]ÐUU RURh"!+_]ÐUE 9E%]ÐUWVSUE M]u8%%e[^_]ÐUEPEPEPEPURE@%PURURUR&]ÐUEU Љ]ÐUEU ЋUE]UEPEPEPEPURURURURURh8!h視_]ÐUEPEPEPEPhD!UR萖_URURURURW]ÐUhP!藒_hs!荒_jjjjjh!y_]ÐUh!g_jjjjjh!S_]ÐUSEU M]]]ÐU4WVSU} 0Љƃ~t"tRh "Rh"Pb_ ="u#"Ph"h `_ h!"S_ktC;uE PSh#"P_19u ~+PhSj_ tF9u 9u 0ЉƃVRS譏_ t(: u CECB:uh `S_01t CF0щȃ9r1UJ9} .CF9|,"h `P跊_h/"h `荊_Pމ_[^_]ÐUh `_h@"h `P_MQM QMQUE8tRPh `_hB"h `_jP]ÐUh `臉_hE"h `_URU RUR3EPURh `荕_$h `hG"軉_!!9"}j]ÐUh `_hK"h ``_U E 8tRPh `_hM"h `7_jq]ÐUh `览_hP"h `_hR"h `_U E8tRPh `觔_hy"h `Ȉ_j]ÐUh `7_h|"h `萈_E PURh `N_h `h~"_! !9"}j]ÐU SE],tPh"EPT_ EPU(RU$RU RURURU REPURh"UR_!,!9"}j ]]ÐUS]ah"h `衇_S_UWVS]0PSV_e[^_]ÐUUBu 1]Ð: t: uЉ]UU 8 t8 t]ÐUWU:t0D}]ÐUWS]0Ѓxڐ: t: uJHy|tDe[_]ÐUWS]0ЃU ) CJe[_]ÐUE€8t:/uBB:u]ÐUWU0Ѓ9v8.u H9w}]ÐUS];tN9t `t#9t `C;u]]ÐUS];tN9t  `t#9t `C;u]]ÐUEuh"h `迄_肁_P҄_]ÐUWVSu] 0P薈_uPS6V_e[^_]ÐUSUR[_Ãu؋]]ÐUh"{_j\_UWVS]u h"_u"h"ل_uh"Ȅ_tu"0҉ЍDP藇_ǃ;tVSh"W蘌_Vh #W脌_ WӇ_e[^_]ÐUWS]0Ѓx</ttڐJHx:/tuu ;/tt}1SPPh#h _e[_]ÐUWU0Ѓx </tHyDPh#hË_}]ÐUWVS]u } #tVWShT#h `b_L#5D#=e[^_]ÐUE)]ÐUWVSE=d#t*d#1DŽ=~11҃t:@~u9jhh#h{#E͐huV]]+]P9ǃ(0}ҋ=0#P _t'50#Vj/uVh#P_E#hlh#h#&hX&~BlP%CÃWSaAVSAV<W<ߋltttUz4t J4Q<lJWBMA4t]W<UB8B4ehlhg(h(Dhlh(h(|$hlh(h(\W<L[^_]ÐUWVS]S8C49C@t9{@uhqh(h )hqh)hA)@PK$QFu>hqhR)hn)K$ P# {@tK@QC$P&뫐1C(9x1@UT0|0uORWSgPC(@PSu{@YK@QC$P&&C@>|0uIRWSPC(@PSqu){@K@QC$P%C@GC(9x@{@tK@QC$P%C@1e[^_]ÐUWVSu~4tF48&jh)h)uM yu'0}ЉÃU Z M Q/]EPSURM QPÃu1hoh)h)U R] u+hoh)h)M Q\URF$P#uM Q\}WjEPjURN$QIÃu,hjh)h *HV$P#MQ}U zu0}ЉÃ M Y SURM Q^LËURF$P#tuhqh*h3*MQV$RChrhB*h^*aE@PN>EWE@PMQjURN$QHÃu-hkhm*h*9V$P#MQF4V8PMQ5>Eu#hsh*h*oM@PV$R?ǃuhkh*h*&MQV$RBu;hrh*h+N$ P#URF$PO"MQF$P1"U@PRjWN$Q&IÃt1hkh&+hF+v$5P#?jWURM QVÃuUR6MQ61؍e[^_]ÐUWVSuU ]zu0Ѓ B PSRI tu&hqhU+hm+bv$5P#1e[^_]ÐUWVSjjMQuVÃ} 9^-rMI$ P#URMA$EUR6ǃuhlhM-ho-'NVMPWjURMI$QA@ÃuGhjh~-h-UR$P#MQUB$P}MY8A4U9teSRWb6@PWjMQUR$R\Aà MQUB$P9;hkh-h-URMA$PUMI$Q=URMA$PURMI$Q9ËUR$R=uhrh-h.`@PUR$R6ƃuhlh.h=.1@PWjVUR$RU@Ãt0hthL.hx.LMI$ P#.jVURM QUR ÃuW-1e[^_]ÐU@WVS]u 0ҋ=0#Pc`_ǃuhlh.h.0#Rj/Sh.W?e_jWX_u jWEPSCe_uO=< `thgh.h.sVS-`_uqhgh.h/ XfEf%f=@thgh/h5/VSY_u!hgh?/hk/"%PW&Y_PY_WR[_1e[^_]ÐU0WVSuURE PV# ujhu/h/>jQUR.} 0щ}щR+ËEPU Rh/Sc_ Pj/)Rh/Vlc_j0щʃRSj h@jEPj}tMQjVjNǃDS2+ujh/h/>WB>h/RY_ǃ u*hgh/h0/PURE Ph0WrY_WX_[^_]ÐUxWVS <#QE PMQ^ ujh0h?0Pj/ME)PhK0Sb_MQj@Sv9 u5hghR0h~01P#E @ 19p1ېM I|t_E P ׅ}$)tM A )ЉA M QD<v| u!؋M APOM QD E @M I LE @D M A F9qgM Q Ӆ}$)tE H )щH hP#1AE @ PM IQE Ph0]S`_Dž0҉ЃPSjIQP:‰0։10M 9q1ېE PL QDPLQTRh0P`_0҉ЃPQPIQP9‹0у,FuE 9pathkh0h0AjPjIQP9ƒt6hkh0h0 P#Ph1ME)PU_à u9hgh1h-1 QhC1ha1P <#QE Ph91S]U_ST_1M 9q~S1ۋE P|t8MQ|QDPTRM QEPƒgFM 9qEE+EP 1|[^_]UWVSj%dxjjPY_j%dxEP$Zu2hkhm1h1 xQ1uVjEPjSR5NjUUu*hjh1h1xP{fR$tVEPtQjSE@$P5ǃu?hjh1h1+ xQtP$MI$ P#1tp1ۀ8 tCp< tOvCPu4hkh1h 2xPtQuSpPVkW_ D+0҉҃px P xQxPh2V\_ǃup x QEP>\_duQxz}qChkh%2hF2hjhc2h2 xQtPx#1Rd RP #dxBRd RP"dxBEDžxx9JlEh11ۋp9 tCp< tOvCPSpQlPU_ D+l0҃p|PMQEPhQhS2lPdZ_ǃh0҉dR!dx`PdL2h0҉dRhP`ID1P xIED1 xIED1x|KD1 K|1tPUׅ}$)t E)ЉESD2<v|2 uCP? xRD2 xMBL0|Exx9J25xEF UӅ}$)t F )ЉF tQ xT[^_]ÐUWVS}u]?t R t919w~#1ېG|t DPp F9wWR[ WU 1e[^_]ÐUSEtÐ؋[4t P% u1]]ÐU,WVSUh2)ЋPN_ƃu 1MQM Qh2]SW_SÁ}ԐWh2VN_Wh2VN_u9]uۃt#t9]uCV U_uV}M_Sh2h|5W_|e[^_]ÐUWVSUr 1E9 ~\1ېPURNW_u'PU R2W_u x>?Eu U9 e[^_]ÐUSM19t1A9u%]]ÐUWSD#0҉߈tSL#Ph2h `L_e[_]ÐUWVSUj)Ѝ4PEurP1X_0щMQËVSV_0щȃڃJ9v:/uSW_ScL_Ee[^_]ÐUEM Q)‹R ]ÐUWVSh2URK_uhgh2h20ۋ}щQ}щʃRwEPRU_}щʃ2Bf2fBURPT_щT h2PJ_ u+hgh3h3GRhVjJ_ 0щƄ t t C;t; u{{t{ tG?t? uG} tRU RVS_t; 0щƄ RVI_/WPgS_RKU_ PI_URU_jjPWI_PRRH_EPR,M_ PT_RaI_PUI_1[^_]ÐU WVS1h&3}WH_u!hgh(3hC3MQhSzH_ tF䐐}tQ)Pg}QJO_1ېQڋ}BPRhO3QHH_Wj/MQhY3>PQ_(?)9} tW!G_M 1[^_]ÐUWVSuU 0Ѓ]9~SRVLQ_3e[^_]ÐUS]1{tFjjRAK_ t-jCPRS_ %tP#Sr"]]ÐUUB< t<t< u ]ÐB ]ÐUWVSU}EtR1ۋMA(pRT tt u ] \EMA(M9H1PD2< <t< w] \2tKL2CEt Ct {t;t QC{ CP] \2tKL2CEt fCt#f{t;t QIfCf{CPs] \2t KL2KMt Ct#{t;t QCt{tKQeEMA(M9H@Ee[^_]ÐUVSu] jjjSV{Lt`$#tW$#t%=3uh`3oI_ 3jL_$#t=3t3됐e[^]ÐUjU RURL]ÐUEP]UEPPP]ÐUh3 jlB_UWVS]u } #tVWSh3h `B_353=3e[^_]ÐUUR]UVS3P#3333L#3D#3=3u 3PUR. Ãu 3и|uiSSB}&jh3h4u%h4B_t pAe[^]ÐUS]3P#3434L#4D#4S-]]ÐUWVS}u ]3P#3434L#4D#4SVW ujh 4h54.t CPjh>4hS431e[^_]ÐUS] 3P#3\43\4L#]4D#]4{Pt SPRiURSUR | #jh^4ht43и]]ÐUEU R@TPu1]Ðjh}4h4]ÐUUR]UjjU RUR]ÐUWVSE13P#3434L#4D#4u MMy,tQ,RMA,VU~NM]j8B_Ãu-URhlh4h43иfjMQSC US$K({,C0C4 }tUZ4}u]}TUMQ,1e[^_]ÐUWVSu} 3P#3434L#4D#4t3x3u~4mF48a\GF,x4thhh4h4)V:1u-jh4h4,3и uP1RV*à tt3t3t3~,t*UVu3иi\~4tF48Et @F8 F8t3 #tv4Vh41e[^_]ÐUWVS}u 3P#3535L#5D#5s=t3FwH uP1RW;à tt3it3URVWWà u!t323t3uW!4tG48 VURVW tttjh5h53Љ؍e[^_]ÐUWVS}u ]3P#3%53%5L#&5D#&5 u SjWnSVWdà ؍e[^_]ÐUE #]ÐUE$#]ÐUS]S@RC$P6C@]]ÐUE@@]ÐUWSh `>9_E PEPh `dE_h'5h `9_30ۉ׈tR3Ph)5h `S9_=D#tzh75h `,9_D#PPhK5h `9_=P#thZ5P#P=< `t(< `9B`|@`Rhs5h `8_ De[_]ÐUWSh `.8_E PEPh `TD_h5h `u8_0ۋ=3t33P3Ph5h `@8_3Ph5h `+8_=D#t3L#PPh5h `7_D#Ph5h `7_=P#th5P#P=< `t(< `9B`|@`Rh5h `7_ e[_]ÐU3P#3636L#6D#6]ÐUWVSE0}Ѓ]K9]s;/u9]t`hj7_Eujh6hA6CURC4_uC/jhN6hu69hj\7_ƃujh6h6 0҉PB:_ǃu1hlh6h631SVh6W?_jW2_t$jh6h6jW2_tjh6h 7FjWp2_tjh7h+7&}t*UR3_ujh87hX7819]tC/e[^_]ÐUWVS}1ۋG(9X~91@D0PW,R>_uCG(9X̸e[^_]ÐUWVS}G(p EM9HEP}D:<v|: uzMD < tB<tg< tLW] }\:C;] M\ C] }\:sEEMA(}9xVMyPt yPWVMAPEA(@ P} WMQ 8_ }G(H ME}9x1PD2<v |2 D2< tX<t"< tl] \2CP Q}W7_ C.] \2CP Q}WP7_ Clj}*] \2KQ;WMQ!7_ []E}G(M9H e[^_]ÐUWVSEMA(M9H~a1PD2<v|2 u7D2< t<t'< u] \2;t ShEMA(M9HMqPA(@ PVM QR6_ MA(p EM9H1PD:<v |: D:< th<t"< ] \:{CPuSRVP5_ C;] \:f{tbCP8SRVP5_ CƃB] \:{t#KQKQVPE5_ sEMA(M9He[^_]ÐU WVSUB(JPH MEU9PnEpMD<v | 1UD< tv<t < ] M\UBPD@8Ct3}KCE] M\UBPDf@f9Cft3}KupCEp] M\UBPD@9CuKt3}u9[]:MA(@qPUt} |D t EEUB(M9H1e[^_]ÐUUR 3_uhe7h `._j'._]ÐUEP._]UVSu]CPU RV8_3e[^]ÐUVS]u{t;t RtSVPVU RP2_ Ce[^]ÐUVS]uf{t;t RAtfsVVU RP;2_ fCe[^]ÐUVS]u{t;t RtsVVU RP1_Ce[^]ÐUhj16_hj6_0$]ÐURj5_=tj._P0_0Rj5_=$t j._Pt0_]ÐU]ÐU$]ÐUWVS}} M9U :M9U :MM Pƃu 1EU 9:|VUM9|0MUMU9u MMGECU9}܃EEUM 9}t"O>VV+_"V+_je[^_]ÐUWVS}} MM PEMQMQM9M 91|dMM M1ҋM9~&MM MM9u@u9E}~M MMGEFM 91}t%OM9QËMQ*_MQ*_1e[^_]ÐUU @PRMQ._]ÐUWVS]u ;LV>PRQg._63e[^_]ÐU WVSuEEE} 9|Y}<}9|F9tVA9| 9u9};E8EEEEE} 9}e[^_]ÐUWVSU} uRhx7._e7?u7PQRh7._9|.wQ7~7Ph7._ C9}h7j._e[^_]ÐUVSuR ÃtVS`؍e[^]ÐUWVS}4V,_ÃuWh7._ VjS,_؍e[^_]ÐUWVSuU 9|9VtFC9|9u9}1fHPgE9}MV:9@9|C9| }9:C9}6N}7Ee[^_]ÐUVSMu ]9|!A9u0B9}e[^]ÐU WVSMyQRh<8,_EEPMI QUR$RMQURRMQEtO}UUMq$19}%>tRNQShO8U,_C9|ރ}t$hd8,_e[^_]ÐU4WVS}EE} .WhE} }EPO QO$QMQOQWẼ3}u_$u_$u19M 9K|u M؋C+E = v"E E܋E 0K)MM EEKMjEPMЍPOQWVEB9wMMЃ}u }W}unOM؋GE GM MEEEEW t-!WFSW6CER"EEEEEPMQWuEE؍e[^_]ÐUVS]R,"_{$t S$Rj$_Sa$_e[^]ÐUEU uSt:u* 9Q 9Qh `$_]Ð 9QR 9Qh `#_]Ðxu=< `tR)_]Ðt:u@49P뇐@49P뚐UDWVS}] EPSW 9_uGM}~EPSW}u}t*SWuEPSW p]ȋMM̃hW@GCWtOQW&G$G$@jO$QjOQWWWZEPOQW E9Ev2jEPMQOQWrEPO QO$QVOQWEBu_$Eă_$E19}]u;uGjEPMQOQWWW1EB9|}uuNMɉMԋ_؃ȉGER"MMEEEEPSWZ tfSOQWw* tSjuVMQSW&t:OMȋMMjVMQSWt_WWWe[^_]ÐUWVSu] }u FJjSRA$_ 9u.jWR&_tӃu!?R"u1Fe[^_]ÐUVS]=:u{u 11jjSRR(u:e[^]ÐUE=:tjPRP(:]ÐUSj(m#_ÃhV#_C$C MQE PMQ>$_‰ |kjCPRW%_ u)CR"CCCSu/{R"u&CC CS_1]]ÐUVSu] jSR"_ 9ujURR%+_tF1e[^]ÐUWVS}]uEEPU RW tq9E~E9E}u)ޅ~/jU \SR!_ 9tG-VUR?W$_U92u E e[^_]ÐUPWVSu0EEPU RV UȉUtE}̃tÀ}tEPURV tEPURV tj}tỦUtUȉUEEEPU RVT t0tEPWV= t}tEPURV!u1e[^_]UWVS}uEPM QW t9u| E9E}Gt}~*jUM \SR5 _ 9tGVMQR(_ 9uE9E}EEPM QWYt1e[^_]US]jjR_ ujCPSp(_t1]]ÐUWVS}W& E?tR7_}E@t W@Rr_w8t^ VR\_VV_ރuWG_Ee[^_]ÐUWVS}uG 9vG  GWVVU RW!uW]W$JUG@ЉEPWE ÃuW&SREPEPWRW(RVU RuWduG W>GU9W,upCx ug@C@SW uWzG$W u WQWJ!Cx U9W,tx xjW ƃuWtVRSRURSVCSWD tVW5 uW GW 1CUptPRWu ÃuWV CpSW uW. tKVW Ãu W xCUSWj uW SURW t-MG@UDEG@ЉEPW ÃWg e[^_]UWVS]} uC 9vC CS VWSr}S$C@TRS teHKC@PCPMQKQK(QVWuS 17tKS C S e[^_]UWVS1UB@J,UB@PRtǃt0MAD9u2ADADPQ@R_MA@u_{uGOUJ} uG@ BUBMA1X} t{ uFUB@[:FMI@CGP)‹C e[^_]ÐU,WVS] }G 9EvG}MA}W MQSWTuW}O$IMG@ȉEjWEu W`}}MA A Q )Ћ}GE܋MQS}W1_ MM}GMQWxƃ~WEPEPMIQ}(WMQ}WuMA ^{}u}GVCFP)‹[ ‹EM V}W-tMQWu}W%MAQ-Fx @UM9Q jQQÃ{WNQ}WEPMQ}WgNKFV}W} t!SWntMQW\u}WfMAQm}W'EjWÃjWEԃEPMQ}ԋWKQ~WMA A P}WEPMQ}W>MԋA}8QF@BSFFE؋CMH}{}ԉOF(VMQZ>S}WD(MQW.}t<}WMQƃF}xVMQ}}}M9y,QEԃjMQ;ƃj}W#ÃvF@F@ F@FMH{WNQjEP}WMQF}ԉ{SMQ$ }WMQ V}WMԉO,G$GWGW>1M}G@MDEG@ȉEPWƃM}9Ot5}MA A Q )Ћ}GEVMA A Q )Ћ}GEOM!t V}W}tMQ}WMQ`e[^_]ÐUS]{tjjR_ ujCPR6_t C1]]ÐUVSu^8tH;u;{t5jSRR3_ 9CuV RSRR_ 9F t [ u1e[^]ÐUSMU zu9Q8} 9QWs_ 9Cű~ W{W>W_ 9F uSV]1e[^_]ÐUVS]u VSƒt5BK0B@RS)ts0CSDe[^]ÐUVS]{0us4S S4#S0RSfts0@C0CSte[^]ÐUEjjjjP]ÐUS]SjjS{]]U(WVSEEEEEEE;E1jH_Ã5CCU u"F$ <\l|zJMEJMEzJMlJMYJMLJM<JM܃JM#JMu JKrMQMQW_ SjCP Q_ƃMQj _ǃMKMK MK(C$MK,C0ɉK4CSluG GGGjMQ Q _ 9EuMQW Q_ 9Et1W_M9KC$CDP _C@C81E}tMQMQSv }uaEXjE _Eto{8uC8MqAA K Q _MAt9tN uM}uMK1Y]9]@u} 9G u'w]3(}}e[^_]ÐUWVSUEJ A}O M JO JOJOz}]BЍHM)Ƌ}GH)MR E ȉEEE}M9y M9Mu`}uZ1ҋ} 9}}M ECB9U }u M } }M OE} }M9M9M}u*1ҋM9~FM ECB931M ECB+F9|EM}}}}E}EM}9O e[^_]ÐUWVSEE} W J}W } }} W}W} W}W}] } GPU)EU9W }9}u8u19>~ CA91ɋ+F9}CA9|M_}u*1ɋU9~G}CG}A931}CG}A+F9|E}U 9z U}U 9z uztz)U z+}UzU BЍx})ƋUBЍx})ËU R } ؉EE}U 9z ~wU9Uu}}SU B H9Eu$zt}9z u9Uz#+U}}EU} 9W e[^_]ÐUWVSuM }y u]1Y]AȍP)‰Ѕu+\DE]99AȍP)‹I Ћ4]3?W]S]S_1e[^_]ÐU(WVSEEEE}}] MAȍP)‹y ‰UM A}GP)EEG 1M9Mu8}u219U ~M ECB9U } }Eo}u*1ҋM9~M ECB9>}61M ECB+F9|+FEE} utM؋}D9EseM y}Gy M؉M}t} O UM)щO}(t,},BM(M܉ƒtK }܈O}Ju]$E؋MA @9E}u}؋M +y M$y E؋M +A H}$G EM +A+E}$GAȍP)‰U܋MAȍP)Ƌ}  ]EEEA -M9Mux}urE}9}u&Myt}} OE}?;}t E@9Eu } M M܋} y9M MX}9}u(Myt}} OE#}?;E}>M܉9EEM9Mu@}$GP)‹O ÉU܋E} G)EMyuGE؋}G @9EMyM$ye[^_]ÐUWVS]u S{u"uPSC{WS,uCKu QC9B ~{uA@AC{tBSRSuC두A@ HCu{uA@ CCUUS!XURURURURIQSR?tSC1Se[^_]ÐUWVS]}1C@K,C@PStM@xu 1wPS@RC@PKQK(QWM QuC 0CD9u CDCDPK@Q_C@tFhe[^_]ÐUVSuF$V V,F0V ҉V4FVtkjVÃtZV,SC@ C@C@C@V4RR7_tSV e[^]ÐUVSu]=pAt 1jU RV|_ uhtA_j+_}ffUfEEUUEPtPV_ u+=< `#uhA`_jA_t j_봃%e[^]ÐUE=pAt1]ÐfEfEtU UEEEPjUR_]ÐUWVS}1ۋU9U u 1[EPW RW$RSU RWƃt/URW$RSURWtt]u1e[^_]ÐUVS]uC 9vC\S6jjR_uVU RRI_ 9tS(CS1e[^]ÐUS]C 9EsC_Sjj Q&_u C PM Q Q[_S 9tSCS1]]ÐU@EPUR_fEf ]ÐUhBUR/]ÐUhBUR]ÐUjURr_]ÐUhUR_]ÐUURU RUR\_]ÐUURU RUR_]ÐUUR_]UUR_]UEP_UU)Ѝ<]ÐU塤]ÐUS]M 1ҡ tB됐]]ÐUEE ]ÐU< `]ÐUURl_]UUR<_U]ÐUU1vvfvfvfvf@]ÐUfUf~ ff~ff~ff~ff~]ÐUWVSBEH#4B>w<(Ct$(C8<(CD+D9s2v DQPh(rDǁ(=DD5D]VfE$D$DEEʚ;t%C9r9Ev ]EUڋu݃}t7M9M9U)v EPREfE:Ћ$Dt" $DS)vsPRff@f~ȁ'w`D+D9s2v=DWP_h(2D( D5DD);:Vr5$Ce[^_]ÐUVSu BEH#B>ww (C4(CS $D^4$De[^]ÐU8C D9~;9Ju6VE} P} 77u}7e[^_]ÐUVS]u URlSPe[^]ÐUWVSuf] Ãǃ9=@E=UffT R)fÍIf÷f]fEEfEeft5ef9{uURRufCfufee9eujhehe eePUROf{EfEefSfefEeee[^_]ÐUE U9es]ÐPeR]ÐUUeЉ]ÐUe]ÐUVSuSE PqVSB_[^]ÐUVSf95e|4Shgn_Sh `h `j _fFf95e}͍e[^]UVS1Shg*_1f]eft efBf\fuPhg_fEeft,h `j d_Sh `ef\fuh `j 8_fFf`ePhg_e[^]ÐU1ҐfEefBf~fejhgfE]ÐUSu1=t@<uÅtKu]]ÐUSh=htЃ;uhN_]]ÐU=gug]ÐUURURU RURh `_h `y__S\$̀}أg[Ð[ÐSV\$̀}أg[Ð[ÐS\$L$ T$̀}أg[Ð[ÐS[\$L$ ̀}أg[Ð[/lib/ld.so: can't load dynamic linker '/lib/ld.so' statically linked 8UWVSl$L\$P=gD$D bht[|$ ft8t@8u+PSj j*D$Pj hZ񐐐hhhgT$\RSD$ PPD$\ЋT$,RT$,R &|$+jD$PjM j[^_]8ÃfT$fur|$fD$f%fD$f%?fT$f fD$l$ÐUWVSl$|$190v 1WUT$RЃ C90w[^_]Ðlibc.so.4DLL Jump 4.5pl26void0?$0-help%s: class="%s", Prog %s%c%s.trCannot access AST file "%s" (errno=%d)VSRC: "%s" is not a creatorClass "%s" is deferred - cannot be system root%s/_%.*s.%swCan't open "%s" (errno=%d)VSRC-1: Class "%s" is generic - cannot be system root#include <%s.%s> main ( int argc, char** argv, char** envp) { %^%s *root; #ifdef NO_OPTIMISATION #ifdef EIFFEL_TRACE %^_ert_initialise ( 1, argv[0]); #else %^_ert_initialise ( 0, argv[0]); #endif // EIFFEL_TRACE #ifdef EIFFEL_TRACE %^_ert_set_trace_mode (); #endif // EIFFEL_TRACE #endif // NO_OPTIMISATION #ifdef EIFFEL_DEBUG %^_ert_set_debug_mode (); #endif // EIFFEL_DEBUG %^_ert_cenv[ _ert_depth].caddr = 0; %^if ( setjmp ( _ert_cenv[ _ert_depth++].jmpenv)) { #ifdef EIFFEL_TRACE %^%^_ert_terminate ( 1); %^%^_trace_back ( 1); #else %^%^_ert_terminate ( 0); %^%^_trace_back ( 0); #endif // EIFFEL_TRACE %^%^exit ( _ert_exitcode); %^} %^root = new %s; %^root->%s ( VSRC-2: Creation procedure "%s" has too many parametersARRAY:STRINGVSRC-2: Creation procedure parameter should be of type ARRAY[STRING]_ert_make_array_from_nv ( argc, argv)); #ifdef EIFFEL_TRACE %^_ert_terminate ( 1); #else %^_ert_terminate ( 0); #endif // EIFFEL_TRACE return 0; } Database error: could not locate class "%s"Creation feature "%s" is missing%s.%swCan't open "%s" (errno=%d)%s.%swCan't open "%s" (errno=%d)%s: generating "%s" // -*- C++ -*- #ifndef _%s_H_ #define _%s_H_ #pragma interface /* [%s %d.%d.%d.%d] * * * * source file: %s.e * */ #ident "@(#)class_hdr:%s" // -*- C++ -*- #define _%s_C_ #pragma implementation /* [%s %d.%d.%d.%d] * * * * source file: %s.e * */ #ident "@(#)class_txt:%s" ANYPLATFORMGENERALGENERALPLATFORMANY// Indexing: class// // Ancestor classes: // // // Ancestor classes: // ANYGENERALPLATFORM#include #include <%s.%s> : public virtual , public virtual ANYGENERALPLATFORM : public virtual ANY { public: %^int _base_id; %^int _rescuing; GENERAL%^void *_BaseType (int); VMFN: "%s" Duplicate featureVDRD-1: "%s" Duplicate featureVDRD-2: "%s" Signatures do not conformVDRD-4: "%s" Needs a redefine clauseClass is deferred but has no deferred featuresClass is not deferred but has %d deferred featuresClass is not deferred but has a deferred featureVGCP-1: Creation clause not allowed in deferred class#ifdef NO_OPTIMISATION #endif // NO_OPTIMISATION }; // class %s C#ifdef NO_OPTIMISATION %s *_%s_chk(%s*, char *); #else #define _%s_chk(a,b) a #endif // NO_OPTIMISATION #ifdef NO_OPTIMISATION #endif // NO_OPTIMISATION #endif /* _%s_H_ */ // // Class: %s (#%d), Cluster: "%s" // Version: %s, Built by: %s, on: %s // %s%c%sC++ extern "%s" { free#ifndef _DEBUG_MALLOC_INC // Small problem if using C Cahill's malloc debugger %s %s ( ); free#endif // _MALLOC_DEBUG_INC } #ident "%%INDEX=// "%%INDEX=%s: Illegal manifest constant%s, "bad list%s%s%s; %s %s = (%s)0defined (%s)class %s%s// %s is obsolete: %s #include <%s.%s> class %s; EXCEPTIONSVHPR-2: Class "%s" is a descendant of "%s"// features selected from %s Unknown entity. "%s"Class has no feature "%s": cannot selectinline %s %s ( return ) { %s%s::%s ( ); } // %s features renamed ; VHRC-3: Class already has feature "%s": cannot renameVHRC-1: Class "%s" has no feature "%s": cannot renameUnable to add "%s" to hash table, error = %d prefixVHRC-4: "%s" must rename an attribute or parameter-less functioninfixVHRC-5: "%s" must rename a function with one argumentVDRS-3: "%s" appears more than once in Redefine listVDRS-1: "%s" does not exist in "%s"VDRS-4: "%s" does not exist in "%s"void_%cA_%s_%sVDRS-1: "%s" does not exist in "%s"VDRS-2: "%s" Cannot redefine a frozen featureVDRS-4: "%s" Cannot effect deferred feature via redefinitionVDRD-5: "%s" Cannot redefine an effective feature as deferredVDRS-2: "%s" Cannot redefine a constant attributeVDUS-1: "%s" unknown in Undefine listVDUS-2: "%s" Cannot undefine a frozen featureVDUS-2: "%s" Cannot undefine an attributeVDUS-4: "%s" Cannot undefine an External routineVDUS-3: "%s" Cannot undefine deferred featureVLEL-3: "%s" appears more than once in Export listVLEL-2: "%s" unknown in Export listappend_feature_nameappend_feature_nameappend_feature_nameappend_feature_nameappend_feature_nameappend_feature_nameappend_feature_nameappend_feature_nameappend_feature_nameappend_feature_namebad feature nameVGCP-3: "%s" appears more than once in feature listVGCP-2: No procedure called "%s"VGCC-6: Root class "%s" requires a general creation proceedure (unrestricted)VGCP-4: Only one creation procedure for an expanded class, "%s" Warning! Client class "%s" not found in universe Warning! Client "%s" is a generic parameter of "%s" VFFD-1: Constant "%s" requires a typeVFFD-1: Attribute "%s" requires a typeVFFD-1: "%s" is not a routine, arguments are not allowedVDRD-2: Redefined function (%s: %s) does not conform to seed's type (%s)_FA_%s_%s_AA_%s_%sinline virtual const %s %s; %s %s() { return _get_%s()%s; } %s %s::%s { voidreturn (%s) %s (, ); } inline virtual void _set_%s( %s val) { %s=val; } inline virtual %s _get_%s() { return %s; } ?VFFD-2: Feature "%s" not unique in feature listVFFD-4: Feature "%s" cannot be Frozen and DeferredvoidVFFD-5: Feature "%s" must have a return type or be an attributeVFFD-5: Feature "%s" should not have argumentsvoidVFFD-6: Feature "%s" must have a return typeVFFD-6: Feature "%s" must have one argumentVGCP-4: Expanded feature "%s" can have no argumentsVLEC: "%s" is an expanded client of expanded class "%s"VFFD-7: Once function, "%s" cannot be an Anchored typeVFFD-7: Once function, "%s" cannot be a formal generic nameUnknown entity. "%s"Unknown entity. "%s"Unknown entity. "%s"%^%^%s = new %s; Unknown entity. "%s"Unknown entity. "%s"%^%^%s = new %s; voidVFFD-1: Constant "%s" requires a typeVFFD-1: Attribute "%s" requires a typeVQMC: The initialising constant is of the wrong type. Should be "%s" : , %^%^_FA_%s(%s) : , %^%^VQUI: Unique constant is not of type "INTEGER"_FA_%s(%d)%s = 0; %s = (%s)0; Unknown entity. "%s"result->%s%sPOINTER = _ert_%s_Copy ( %s) = _ert_%s_%s_Copy ( this) = _arg->%s = %s->_localClone ( 1, 0)->_Copy ( 1, 0, _arg->%s); Unknown entity. "%s"if ( _ert_%s_Equal ( %s, _arg->%s) == false) if ( %s->_Equal ( 1, 0, _arg->%s) == false) return false; get_new_feature_list ( , )()Error: entity typed Void, %s , local entity is typed Voidprint_local_decl_groupprint_local_decl_groupprint_local_decl_group:VTUG-1: "%s" is not a generic class. Generic parameter not allowedVTUG-1: "%s" is not a generic class. Generic parameter not allowedwaswereVTUG-2: "%s" has %d generic parameters, %d %s expected:VTUG-1: "%s" is not a generic class. Generic parameter not allowedwaswereVTUG-2: "%s" has %d generic parameters, %d %s expectedBITCurrent:Could not determine type of "%s" for Anchorbad type mark() const { return (%s)%s; } = %s = %dillegal feature type;routine{ %s result = (%s) 0; result#ifdef NO_OPTIMISATION #ifdef EIFFEL_TRACE if ( _ert_trace_mode) printf ( "%%*s+++ %s.%s\n", (_ert_trace_depth++ * 3), ""); #endif // EIFFEL_TRACE _eiffel_rt_Assert( EXCEPT_NESTED_FUNCTIONS, "%s", "%s", "env table size exceeded", (_ert_depth != _ERT_JMP_MAX - 1), (_ert_longjmp())); #endif // NO_OPTIMISATION _ert_cenv[ _ert_depth].caddr = this; if ( setjmp ( _ert_cenv[ _ert_depth++].jmpenv)) { if ( _ert_signaled) continue_action ( _ert_signaled), _ert_signaled = 0; if ( _rescuing) { _rescuing--; _eiffel_rt_Assert ( %d, "%s", "%s", "%s", false, (_ert_depth--,_ert_longjmp())); } goto _rescue; } #ifdef NO_OPTIMISATION #if defined (EIFFEL_ASSERT) && defined (EIFFEL_TRACE) if ( _class_assert) { if ( _doing_invar == 0) _enter_routine ( c_object_address, "%s", "%s", _make_arg_list ( , (char *) 0)); (char *) 0)); else _enter_routine ( c_object_address, "%s", "%s", _make_arg_list ( 0)); } _routine_start: try { #endif // EIFFEL_ASSERT && EIFFEL_TRACE #endif // NO_OPTIMISATION ^#if defined (EIFFEL_ASSERT) && defined ( EA_REQUIRE) _require_done: #endif void_%s_once_value = result; _routine_exit: ^ #ifdef NO_OPTIMISATION #if defined (EIFFEL_ASSERT) #if defined (EA_INVARIANT) %^_class_invariant("%s"); #endif // EA_INVARIANT %^if ( _class_assert) %^%^_leave_routine(); #endif // EIFFEL_ASSERT #ifdef EIFFEL_TRACE %^if ( _ert_trace_mode) %^%^printf ( "%%*s--- %s.%s\n", (--_ert_trace_depth * 3), ""); #endif // EIFFEL_TRACE #endif // NO_OPTIMISATION _ert_depth--; resultreturn%sBOOLEAN ? true : false; _rescue: %^_rescuing++; #ifdef EIFFEL_TRACE _ert_trace_log ( "%s", "%s", EXCEPT_FAIL, _ert_depth); #endif VRRR-2: Deferred routine cannot have a rescue clauseVRRR-2: External routine cannot have a rescue clause } // try default_rescue (); %^if ( _class_assert) %^%^_leave_routine(); %^_rescuing--; _eiffel_rt_Assert ( %d, "%s", "%s", "%s", false, (_ert_depth--,_ert_longjmp())); return (%s) 0; } // %s // Routine body "%s" if ( _%s_once_guard > 0) { voidresult = _%s_once_value; goto _routine_exit; } else { _%s_once_guard = 1; } ( ); (); _eiffel_rt_Assert ( %d, "%s", "%s", "", false, (_ert_longjmp())); bad routine body //Routine body "%s" ends... ; ; bad instructionANYVMCN-2: Duplicate name "%s" in "%s" (can be removed with feature adaption)VMCN-3: Duplicate name "%s" in "%s" (can be removed with feature adaption)%s%c%s.%s%s%c%s.%s%s: Terminated! void * GENERAL::_BaseType ( int _target_id) { return (void*) 0; } void * _base2obj ( ANY *_type, int _base_id) { return (void*) 0; } extern "C" { char *_ert_traceback_map (void*,int); extern char *sprintf (char *, char *, ...); } char * _ert_traceback_map ( void * ptr, int f_id) { %^static char *msg, msg_buf[64]; %^int a_id = 0, s_id = f_id; #ifndef NO_OPTIMISATION %^return "No traceback map"; #endif // NO_OPTIMISATION %^ _again: #ifdef NO_OPTIMISATION #ifdef EIFFEL_TRACE %^if ( _ert_trace_mode > 1) %^printf ( "%%*s*** traceback (%%d %%d)\n", (_ert_trace_depth * 3), "", f_id, s_id); #endif // NO_OPTIMISATION #endif // EIFFEL_TRACE %^switch ( s_id) { %^%^case -1: msg = "Void"; break; // NONE %^%^case -2: msg = "pointer"; break; // POINTER %^%^case -3: msg = "BIBT"; break; // BIBT %^%^case -4: // BOOLEAN %^%^%^sprintf ( msg = msg_buf, "%%s", *(int*) ptr ? "true" : "false"); %^%^%^break; %^%^case -5: // CHAR %^%^%^sprintf ( msg = msg_buf, "%%c", *(char*) ptr); %^%^%^break; %^%^case -6: // INTEGER %^%^%^sprintf ( msg = msg_buf, "%%d", *(int*) ptr); %^%^%^break; %^%^case -7: // FLOAT %^%^%^sprintf ( msg = msg_buf, "%%f", *(float*) ptr); %^%^%^break; %^%^case -8: // DOUBLE %^%^%^sprintf ( msg = msg_buf, "%%f", *(double*) ptr); %^%^%^break; %^%^default: // Error %^%^%^sprintf ( msg = msg_buf, "", f_id, a_id); %^%^%^break; %^} %^return msg; } BOOLEAN_REFINTEGER_REFREAL_REFDOUBLE_REFCHARACTER_REF#include <%s.%s> void* %s::_rev_cvt ( int _type) { switch ( _type) { ANY case %d: return (ANY*) this; GENERAL case %d: return (GENERAL*) this; PLATFORM case %d: return (PLATFORM*) this; } return (%s*) this; } Too many Unique constants - max is %d %^void *_rev_cvt ( int); void* %s::_rev_cvt ( int _type) { %^%s *_ert_cvt_to_class ( void *, int); %s* %s::_ert_cvt_to_class ( void *_v, int _type) { %^%s* _tmp; %^switch ( _type) { GENERALPLATFORMANY%^ANY::_base_id = class_id; %^case %d: return (ANY*) this; _tmp = (%s*) ((ANY*)_v)->_BaseType ( %d); break; %^PLATFORM::_base_id = class_id; %^case %d: return (PLATFORM*) this; _tmp = (%s*) ((PLATFORM*)_v)->_BaseType ( %d); break; %^GENERAL::_base_id = class_id; %^case %d: return (GENERAL*) this; _tmp = (%s*) ((GENERAL*)_v)->_BaseType ( %d); break; %^%^default: _tmp = (%s*) _v; %^} %^} %^return (%s*) this; %^return _tmp; } %^%s::_base_id = class_id; %^case %d: return (%s*) this; _tmp = (%s*) ((%s*)_v)->_BaseType ( %d); break; ANYPLATFORMGENERALVDJR: types of "%s:%s" and "%s:%s" are not the sameVDRD-2: types of "%s:%s" and "%s:%s" do not conformsVDJRVDRD-2%s: Feature "%s" has %d parameter%s, %d were expectedVDJR: Parameter %d of %s.%s is not the sames as that of %s.%sVDRD-2: Parameter %d of %s.%s does not conform to %s.%sVHPR-1: Class inherits from itself or a descendantVTCT: Generic constraint "%s" must be a class in the surrounding universe // Special functions copy%^void copy (%s* p1); %^void %s::copy (%s* p1) { _Copy(0,1,p1); } deep_copy%^void deep_copy (%s* p1); %^void %s::deep_copy (%s* p1) { _Copy(1,1,p1); } clone%^%s* clone (%s* p1); %^%s* %s::clone (%s* p1) { return p1->_Clone(0,1,p1); } deep_clone%^%s* deep_clone (%s* p1); %^%s* %s::deep_clone (%s* p1) { return p1->_Clone(1,1,p1); } %^void standard_copy (%s* p1); %^void %s::standard_copy (%s* p1) { _Copy(0,1,p1); } %^void standard_deep_copy (%s* p1); %^void %s::standard_deep_copy (%s* p1) { _Copy(1,1,p1); } %^%s* standard_clone (%s* p1); %^%s* %s::standard_clone (%s* p1) { return p1->_Clone(0,1,p1); } %^%s* standard_deep_clone (%s* p1); %^%s* %s::standard_deep_clone (%s* p1) { return p1->_Clone(1,1,p1); } resultCannot find type of "%s" in class "%s"resultRFPCUVGCC-6: Target of create ("%s") is a read-only entityVGCG-3: Type part "%s" does not existVGCG-3: Type part "%s" is cannot be expandedVGCG-3: Type part "%s" does not conform to "%s"VGCG-1: Base class for creator "%s" is deferredVGCC: Base class "%s" prevents creation with an empty creation listresultVGCG-6: Target of create instruction may not be a Once: %sCurrentTarget of create instruction may not be Current object%s = _ert_init_%s; _create_%s()%s = new %s; _get_%s()((%s*)%s->_BaseType( %d))->%s->Creation is an instruction, should not have a type (%s); VGCC-5: Creation procedure is required for !!%sCurrentresultbad entityvoidcannot find class-id of "%s" in unqualified callSTRINGVEEN-2A: "Result" must be in a functionVEEN-2A: "Result" must be in Routine_bodyVGCC-4: Base class "%s" does not have "%s" in creation listresultVEEN-2B: Local entity "%s" must be in Routine_body%sRF ( )Feature "%s": Unknown entity in "%s.%s". Not a feature of "%s"in unqualified callToo few arguments to "%s.%s", expected %d, but got none, Too few arguments to "%s.%s", expected %d, but got %dToo many arguments to "%s.%s": none were expectedToo many arguments to "%s.%s", expected only %d, there were %d->_localClone( 1, 1))ANYActual argument %d of type "%s" does not conform to formal type "%s"> %s.%s ( ) void_bibt_%s_%s_REF ( )->VEEN-2A: "Result" must be in a functionVEEN-2A: "Result" must be in Routine_bodyCompiler error: Unknown call type_ICHK_%s("%s", %s)%s:VEEN-1: Unknown entity "%s" in assignmentCurrentRFPCUCannot assign to read-only entity "%s"&%sPOINTER%s = _%s_chk ( , "%s")->item()%s->_Copy ( 1, 1, _set_%s(%s = ->_localClone( 1, 1))BOOLEAN ? true : false); Expression type "%s" does not conform to entity type "%s" in AssignmentCurrentRFPCannot reverse-assign to read-only entity "%s"Target entity "%s" not of reference type (%s){ // Assignment attempt %s __%s; %s* _tmp_%s = (%s*) POINTER()->_BaseType ( %d); if ( _tmp_%s && __%s._Conforms_to ( _tmp_%s->class_id)) %s = _tmp_%s; else %s = 0; } if ( } } else if ( BOOLEANBOOLEANVWBE: Boolean_expression is of type "%s") {} else {switch ( BOOLEANINTEGERCHARACTERVOMB-1: Inspect expression must be of type INTEGER or CHARACTER) { INTEGERdefault: inspect_eiffel_rt_Assert ( %d, "%s", "%s", "%s", 0, _ert_longjmp()); break; } VOMB-5: Inspect constants should be all Unique or <= zero break;VOMB-2: Constant must be the same type as the inspect expressionVOMB-3: Inspect constants must have different valuescase %d: VOMB-3: Inspect constants must have different valuescase '\%d': case '%c': VOMB-2: Constant must be the same type as the inspect expressionVOMB-3: Inspect constants must have different valuescase %d: case '%c': VOMB-2: Constant must be the same type as the inspect expressionVOMB-2: Variable used in multi_branch. Constant attribute is expectedVOMB-6: Unique constant is not a descendant of "%s" VOMB-4: Unique constants must have different namesVOMB-3: Non-unique inspect constants must have different valuescase %d: case '%c': #if defined (EIFFEL_ASSERT) && defined (EA_CHECK) ^ #endif // EIFFEL_ASSERT #ifdef EIFFEL_DEBUG # if || # endif // (DEBUG KEYS) #endif // EIFFEL_DEBUG VXRT-1: "retry" must appear in "rescue" clause #ifdef EIFFEL_TRACE _ert_trace_log ( "%s", "%s", EXCEPT_RETRY, _ert_depth); #endif %^%^_rescuing--; %^%^goto _routine_startC++(void)result = %s %s::%s(void)result = %s::%sVDRD-3: Precondition is required to begin with "require else"#ifdef NO_OPTIMISATION #if defined (EIFFEL_ASSERT) && defined (EA_REQUIRE) if ( !_ert_in_assertion && _class_assert & 0x%x) { _ert_in_assertion++; ^_ert_in_assertion--; } #endif // EIFFEL_ASSERT && EA_REQUIRE #endif // NO_OPTIMISATION VDRD-3: Postcondition is required to begin with "ensure then"#ifdef NO_OPTIMISATION #if defined (EIFFEL_ASSERT) && defined ( EA_ENSURE) if ( !_ert_in_assertion && _class_assert & 0x%x) { _ert_in_assertion++; ^_ert_in_assertion--; } #endif // EIFFEL_ASSERT && EA_ENSURE #endif // NO_OPTIMISATION ExternalDeferredVRRR-2: Local declarations not allowed in %s routine; ^; %^_ert_expand++; %^%s = new %s; %^_ert_expand--; VXRC-2: Only one "rescue" per routine catch ( ...) { #ifdef NO_OPTIMISATION #if defined (EIFFEL_ASSERT) && defined (EA_INVARIANT) void %s::_class_invariant ( char* rtn) { if ( _doing_invar++) return; if ( ! (_class_assert & 0x%x)) return; %s::_class_invariant(rtn); rtn ^_doing_invar = 0; return; } #endif // EIFFEL_ASSERT && EA_INVARIANT #endif // NO_OPTIMISATION %scondition: %dBOOLEANBOOLEANVWBE: Unlabeled_assertion_clause is of type "%s" (should be BOOLEAN)_eiffel_rt_Assert ( %d, "%s", "%s", "%s", BOOLEANBOOLEANVWBE: Unlabeled_assertion_clause is of type "%s" (should be BOOLEAN), (_ert_depth--, _ert_longjmp())); , _ert_longjmp()); VZAA(VUAR-4) "%s" must be a feature nameCUVZAA(VUAR-4) Feature "%s" is a constant&%strue; /* %s */BOOLEANUnable to determine type of Simple expression%s%s ( ) _ert_make_array ( %d, )VAOL-2: `Old' appears within an `old' expressionVAOL-1: `Old' does not appear within a postcondition (b)_Old_%dARRAY:ANYPOINTERillegal expressionNONE_ert_clone_%s ()_REF( (DOUBLE) (INTEGER)_Old_%d_ert_%s_%s _Old_%dBOOLEANBOOLEAN %s->_INFIX_%s (, (DOUBLE) (INTEGER) %s))Infix "%s"NONEEquality "%s": types "%s" and "%s" do not conformBOOLEANCannot find class "%s" in binary expression"%s": unknown in "%s.%s" manyfewToo %s arguments to %s, expected only 1Infix "%s": RH type "%s" does not conform to formal type "%s" BOOLEANPrefix "%s""%s": unknown in "%s.%s" ->()%sUnrecognised operatorANY, (ANY*)ARRAY:%sARRAY:%sManifest array type is "%s" but should be "%s"%sIllegal manifest constant _ert_new_string ( "") _ert_new_string ( Illegal manifest constant)_ert_INTEGER_Const ( %d)Illegal manifest constant''_ert_CHARACTER_Const ( %s)_ert_BOOLEAN_Const ( true)_ert_BOOLEAN_Const ( false)_ert_REAL_Const ( %g)_ert_REAL_Const ( %f)CHARACTERINTEGERREALDOUBLEBOOLEANSTRINGBITNONE"%s"bad manifest constant, %d, %s->_Add_gp ( , %d)while ( 1) { #ifdef NO_OPTIMISATION #if defined (EIFFEL_ASSERT) && defined (EA_LOOP_INVARIANT) INTEGER _variant; ^_variant = (INTEGER); #endif // EIFFEL_ASSERT && EA_LOOP_INVARIANT #endif // NO_OPTIMISATION if ( !BOOLEANBOOLEANVWBE: Loop exit expression is of type "%s" (should be BOOLEAN)1 /* NO EXIT CONDITION */) { } else break; #ifdef NO_OPTIMISATION #if defined (EIFFEL_ASSERT) && defined (EA_LOOP_VARIANT) _eiffel_rt_Assert ( EXCEPT_LOOP_VARIANT, "%s", "%s", "condition: %d", (INTEGERINTEGERLoop variant not an Integer_expression (type=%s) == _variant - 1), _ert_longjmp()); #endif // EIFFEL_ASSERT && EA_LOOP_VARIANT #endif // NO_OPTIMISATION }};Loop has no body - no effectLoop has no exit condition - infinite loop//%cclass.edbCHMandatory option "class_name" not set a:c:de:n:ps:u:v:x:C:D:E:X:F: Usage %s: [options] -n options are: -a {r/e/i/l/c/n/a} Assertion codes -c Class belongs to -d Debugging on -e System starts at creation routine -p Preserve compiler intemediate files -u Class belongs to -v Verbosity level -x C++ file extension -C Set case mode -D Set debugging keys -E C++ Compiler specific controls -O Optimise compile -X C++ header file extension #ifndef EIFFEL_GC #define EIFFEL_GC #endif // EIFFEL_GC #include #define EIFFEL_DEBUG #define #define %c %s: Cluster not specified// // Supplier classes: // class %s; #ifdef _%s_C_ // // Supplier includes: // #include <%s.%s> #include #include #include #include #endif // _%s_C_ extern "C" { strcpystrcatstrlen%s %s ( ); } CHARACTERBOOLEANINTEGERREALBITSTRINGunknown constant typeINTEGERREALDOUBLEtype promotion between "%s" and "%s" not possible INTEGERREALDOUBLEINTEGERREALDOUBLEBOOLEAN _Conforms_to ( INTEGER other_id); BOOLEAN %s::_Conforms_to ( INTEGER other_id) { return false; } INTEGER Parents[%d] = { , %s%d}, i; if ( class_id == other_id) return true; for ( i = 0; i < %d; i++) if ( Parents[i] == (int)other_idINTEGER.value) return true; return false; } void _Add_gp ( void %s::_Add_gp ( , int, int _p%d); int _gp_ids[%d]; ) { %^_gp_ids[0] = %d; %^_gp_ids[%d] = _p%d; } #ifdef NO_OPTIMISATION %s *_%s_chk(%s *rtc, char *fname) { if ( !rtc) _eiffel_rt_Assert ( %d, "%s", fname, "void target", false, _ert_longjmp()); return rtc; } #endif // NO_OPTIMISATION _ert_expand++; if ( _ert_expand) { } else { } _ert_expand++; _ert_expand--; _ert_expand--; %^class_id = _ert_INTEGER_Const ( %d); %^_rescuing = 0; %^c_object_address = (POINTER)this; %^c_class_name = (POINTER)"%s"; GENERAL%^bit_size = _ert_INTEGER_Const ( sizeof(*this) * BYTE_SIZE); %^%s(); %s::%s() { %s%s} %^void _Copy( INTEGER, INTEGER, %s); void %s::_Copy( INTEGER deep, INTEGER sclass, %s _arg) { if ( deep) { if ( sclass) %s::_Copy ( 1, 0, _arg); } } %^%s _localClone( INTEGER, INTEGER); %s %s::_localClone( INTEGER deep, INTEGER sclass) { %s result; result = new %s; if ( deep) { if ( sclass) %s::_localClone (1, 0); } return result; } %^%s _Clone( INTEGER, INTEGER, %s); %s %s::_Clone( INTEGER deep, INTEGER sclass, %s _arg) { %s result; result = new %s; result->_Copy ( deep, sclass, _arg); return result; } BOOLEAN _Equal ( INTEGER, INTEGER, %s); BOOLEAN %s::_Equal ( INTEGER deep, INTEGER sclass, %s _arg) { if ( deep) { if ( sclass) if ( %s::_Equal ( 1, 0, _arg) == false) return false; } return true; } print_generic_decls ( "%s", ...) - class not found %s < , class %s%s> #ifdef NO_OPTIMISATION #ifdef EA_INVARIANT %^void _class_invariant ( char*); #endif // EA_INVARIANT #endif // NO_OPTIMISATION private: #ifdef NO_OPTIMISATION INTEGER _%s_once_guard; void %s _%s_once_value; #ifdef _%s_C_ #define EIFFEL_ASSERT #endif // _%s_C INTEGER _class_assert; INTEGER _doing_invar; #endif // NO_OPTIMISATION _%s_once_guard = 0; void_%s_once_value = (%s)0; #ifdef NO_OPTIMISATION #ifdef EIFFEL_ASSERT _class_assert = _set_class_assert ( 0x%x); _doing_invar = 0; #endif // EIFFEL_ASSERT #endif // NO_OPTIMISATION #ifdef NO_OPTIMISATION #endif // NO_OPTIMISATION E #ifdef EIFFEL_ASSERT %s%s#endif // EIFFEL_ASSERT VAOL-2: `Old' appears within an `old' expressionNONE#ifdef EIFFEL_ASSERT %s _Old_%d = %s; #endif // EIFFEL_ASSERT VWST-1: "%s" is not an attributeVWST-2: "%s" appears twice in Attribute_list_ert_make_array ( %d, vWST-1: "%s" is not an attribute of "%s")illegal routine body%s%c%s.%s%s%c%s.%s_FA_%s_%s_FA_%s_%s_AA_%s_%s_AA_%s_%s_FA_%s_%s_AA_%s_%s->void((%s_REF*) _base2obj ( %s%s_REF((%s*) _base2obj ( %svoid_bibt_%s_%s_REF ( %s%s)_%s_chk ( %s%s, "%s"), %d)), %d))->item()voidFunction cannot be an instructionvoidcannot find class-id of "%s" in unqualified callSTRING_ert_new_string ( Illegal manifest constant)VEEN-2A: "Result" must be in a functionVEEN-2A: "Result" must be in Routine_bodyresultVEEN-2B: Local entity "%s" must be in Routine_bodyVUEX-2: "%s": Unknown entity in "%s.%s". Not a feature of "%s"VUEX-1: "%s": Unknown entity in "%s.%s". Not a feature of "%s"resultVEEN-2B: Local entity "%s" must be in Routine_body Warning obsolete call: "%s.%s" RF(%s*)(%s_get_%s()RF ( )"%s.%s" has no arguments, there should be %d()Void()0STRING()->c_object_address)in unqualified callREI// %s inherited from %s goto _require_done; #ifdef EIFFEL_ASSERT if ( _class_assert & 0x%x) { %s%s} #endif // EIFFEL_ASSERT VNCS-%d: The signature of "%s" does not match that of the deferred feature in "%s"VGCP-2: Feature "%s" not a procedure. Cannot use for creationVDRD-2/VNCS-%d: The signature of the redefined feature "%s" does not match that of the one inherited from "%s"Error: entity typed Void Type mismatch in argument %d of "%s". Should be type %s but is Not enough parameters (should be %d). Too many parameters (should be %d). eawCannot create temporary file "%s" (errno=%d)rCannot re-open temporary file "%s" (errno=%d)void*ANYFeature "%s.%s" not available in precondition "%s"ANYFeature "%s.%s" not available in precondition "%s"Feature "%s.%s" not available to class "%s"Table overflow - too many inherited classesANYTable overflow - too many features%%%s#%s%%%s#%s@%d%s%d@%d%s%d@%d%s%d@%d%s0'%d-0@%d%s%d'%d-%d'%d-0'%d-%d"%s": Duplicate name (%s)@%d%s0@%d%s%d"%s": Duplicate name%%%sINTEGERCHARACTER%dVoidCurrent&%dUnable to lookup "%s" in database, id = %d&%d&%d%s:%sName of parameter "%s" appears in class "%s"VRLE-1: Name of parameter "%s" appears in class "%s"%%%s"%s": Duplicate name#%s#include <%s.%s> %^%^case %d: { %^%^%^%s e; %^%^%^if ( !a_id) { %^%^%^%^s_id = a_id = (e._ert_cvt_to_class ( ptr, f_id))->class_id; %^%^%^%^goto _again; %^%^%^} %^%^%^if ( f_id == a_id) %^%^%^%^%^msg = (char *) ((%s*)(void*)ptr)->out()->to_c(); %^%^%^else %^%^%^%^msg = (char *) (e._ert_cvt_to_class ( ptr, f_id))->out()->to_c(); %^%^%^} %^%^%^break; #include <%s.%s> +%s+%s-%sVTCT: Can't locate source for class "%s"~%%%d~%s~%s~%s&%dUnable to undefine "%s" Feature "%s" is deferred (appears in "%s"). void*%^virtual %s%s %s ( ) { voidreturn %s::%s(); } Feature "%s" is deferred (appears in "%s"). Creation features are: %s %s , InfixPrefix(ANY*)_ert_clone_%s ( %s)CurrentCurrent+%s // Suppliers of suppliers #include <%s.%s> class %s; %s *_%s; switch ( _target_id) { case %d: _%s = (%s*)(void*)c_object_address; if ( class_id == _target_id) return (void*) _%s; return _%s->_rev_cvt ( _target_id); break; } switch ( _type->class_id) { case %d: return ((%s *)_type->c_object_address)->_rev_cvt ( _base_id); } <%s>%s virtual void _create_%s (); virtual void _create_%s (); void %s::_create_%s () { %s = new %s; } void %s::_create_%s () { %s = new %s; } #if defined (EA_INVARIANT) void#define _ICHK_%s(n,r) (_class_invariant(n),_icheck_%s(n,r)) #define _ICHK_%s(n,r) (_class_invariant(n),r,_class_invariant(n)) #else #define _ICHK_%s(n,r) r void* %s%s _icheck_%s (char*, %s%s); %s%s %s::_icheck_%s (char *nm, %s%s rtn) { _class_invariant(nm); return rtn; } #endif // EA_INVARIANT VDRD-6: Both must be variable.(%d %d) [%d] [%s] %c [%s] VDRD-6: Both must be expandedVDRS-4: redeclared feature "%s" must be effective. Inherited routine has been undefined. Routine has been undefinedVDRD-7: Both must be external%s. "%s.%s" redeclared as "%s.%s"% % % % %c     Too many queue markersInvalid queueQueue marker out of sequence (%d,%d)Can't flush from queue marker(%d)Can't insert at queue marker(%d)print%d%f%x%%Output code error (%c)external_addexternal_addexternal_addexternal_addexternal_add(ANYANYexport_addexport_addANYxCHARACTERDOUBLEREALBOOLEANBITPOINTERNONEINTEGERdddddDOUBLE_REFREAL_REFINTEGER_REFCHARACTER_REFBOOLEAN_REF%*s%s BOOLEANCHARACTERINTEGERREALDOUBLEBITvoidi >= 0 && i < bibt_list_count()classaccess.c%s:%u: failed assertion `%s' Memory allocation error in `%s' (%d bytes)\%o@\b^$\f\\~\n`\r#\t\0|L'%s'%\'\"[]{}%cNONEUnable to find class "%s" to check conformancevoid.e.twr^YXSRMLGFA@;%  | z­  zu_3ZM4H853$ ά ɬȬìE|w] XWR= 87 X2!O"Q #$7۫%L֫&U'e|(^wb)f]L*G/+*,- ./۪0 1nu2np[3sVD4q?25&-6$789:ũ;<=>p{_?pZE@o@2Av-BwCEԨEϨFG{HfIaJJE/K*Address Argument ValidityVZAARetry Constraint RuleVXRTRescue Constraint RuleVXRCStrip Expression ValidityVWSTOperator Validity RuleVWOEManifest String RuleVWMSManifest Array RuleVWMAConstant Attribute RuleVWCAVWIDEquality Expression RuleVWEQBoolean Expression RuleVWBECall is ValidVUGVCall is Export-validVUEXCall is Class-/system-validVUCSCall is Argument-validVUARUnconstrained Genericity RuleVTUGVTEGClass Not Found In Specified UniverseVTCTVTCGVTBTVTATRoot Class RuleVSRCName clash in ClusterVSCNRoutine RuleVRRRLocal Entity RuleVRLEFormal Argument RuleVRFADuplicate Feature declarationVREGUnique Declaration RuleVQUIManifest Constant Initialisation RuleVQMCMulti_branch RuleVOMBSelect Subclause RuleVMSSVMRCFeature Name RuleVMFNFeature Name ConstraintVMCNExport List RuleVLELExpanded Client RuleVLECExport: Client exists in UniverseVLCPProcedure Call SyntaxVKCNAssignment Attempt RuleVJRVAssignment RuleVJARVIRWRename Clause RuleVHRCParent RuleVHPRClass ANY RequiredVHAYVGCSCreation Clause RuleVGCPVGCICreation Instruction RuleVGCCFeature Declaration RuleVFFDEntity RuleVEENUndefine Subclause RuleVDUSVDUCRedeclaration RuleVDRDRedefine Subclause RuleVDRSVDOCJoin RuleVDJRVDDCVDCNEnding CommentVCRNFormal GenericsVCFGClass HeaderVCCHGeneral Validity RuleVBGVAssignment ConformationVBARLoop Variant is an Integer_expressionVAVEFeatures Available in PreconditionVAPEValid `old' expressionVAOLConformance in ExpressionVNCXSignature ConformanceVNCSVNCNVNCHVNCGVNCFVNCEGeneral ConformanceVNCCDirect Conformance (Bit_type)VNCBSyntax ErrorVUNDonce_addonce_addonce_add zsjc]VOHA:1,&" writereadwhilevolatilevoidvirtualunsigneduniontypedeftrythrowthistemplateswitchstructstaticsizeofsignedshortreturnregisterpublicprotectedprivateoperatornewlongintinlineifgotofriendforfloatexternenumelsedoubledodeletedefaultcontinueconstclasscharcatchcasebreakautoasm EC? =;6 42- +'#! |yvsokg_WONMLIMPLIESIMPLIESimpliesXORXORxorOR||orOR_ELSEOR_ELSEor elseAND_THENAND_THENand thenAND&&andNEQ!=/=EQ===GEQ>=>=LEQ<=<=GT>>LT<<SUB--ADD++MOD%\\IDIVDIV//MUL**DIV//POWPOW^SUBU--ADDU++NOT!not@&}*x#s|o!j~d?^[X]R(L)F{@}:&4>1<.=++&- \/$ DOLLARSLASHBSLASHMINUSPLUSEQLTGTAMSNDCLBRCOPBRCCLPAROPPARCLSSQOPNSQQUERYTILDABANGBARHASHSTARANDAT*** Cannot translate operator "" to C _INFIX_FO_PREFIX_FO_%sCurrentNN?ANN?PNN*Currentrruldwre, %s, %s %s; %s: like %s, "%s", CORE"?", 0(void*) &%s, %d(void*) &%s%s, 0, %dlike wCan't open "%s" for case mode outputt_node->Kind == kClass_type || t_node->Kind == kClass_type_expanded || t_node->Kind == kSimple_typeectree.c%s:%u: failed assertion `%s' :>VALID %s(%d,%d) *** Validity check failed: %s (%s): "%s" (see page %d) > %s. SYNTAXSYNTAX%s(%d,%d) *** Syntax error: %s WARNING%s(%d,%d) *** Warning in "%s": %s :t_node->Kind == kId || t_node->Kind == kFree_operator || t_node->Kind == kOp_name || t_node->Kind == kChectree.c%s:%u: failed assertion `%s' Identifier expectedt_node->Kind == kString0 || t_node->Kind == kString || t_node->Kind == kOp_nameectree.c%s:%u: failed assertion `%s' not a string valuet_node->Kind == kInfix || t_node->Kind == kPrefixectree.c%s:%u: failed assertion `%s' not an operator_INFIX__PREFIX_t_node->Kind == kInfix || t_node->Kind == kPrefixectree.c%s:%u: failed assertion `%s' not an operatorInfixPrefix%s "Bad character %c%cBad character 0x%x InfixPrefixInvalid %s operator name"""%ld%struefalse%lGCHARACTERINTEGERREALDOUBLEBOOLEANSTRINGBITNONE"%s"%d:0                               vhYJA7-" yjbYPG9*saUH;4! weXQFC<6. xgZLB91'ymaXND5% wjaSLA5(#veTJ?4,# wk_RE=4+ukdVH:/$}nic]WE2/*$ Comment1Comment0CommentIdResultCurrentEntity0EntityString0StringBitseq_NONE_BIT_STRING_BOOLEAN_DOUBLE_REAL_INTEGER_CHARACTERRealIntFalseTrueChManifest_constant0Manifest_constantList2List1List0ListImplies_binaryXor_binaryOrElse_binaryOr_binaryAndThen_binaryAnd_binaryGteq_binaryLteq_binaryGt_binaryLt_binaryNequal_binaryEqual_binaryPower_binarySub_binaryAdd_binaryDiv_binaryMul_binaryIntDiv_binaryIntRem_binaryFree_operatorBin_opNot_unarySub_unaryAdd_unaryUnary_opStripOldManifest_arrayParenthUn_exprBin_exprCallSimple_exprComment_exprExpression0ExpressionAddrActualActual_list1Actual_list0Actual_listActuals1Actuals0ActualsUnqual_call1Unqual_call0Unqual_callCall_chain1Call_chain0Call_chainType_list1Type_list0Type_listAssertion_clause1Assertion_clause0Assertion_clauseAssertion1Assertion0AssertionEnsure2Ensure1EnsureRequire2Require1RequireCondition1Condition0ConditionActual_generics1Actual_generics0Actual_genericsAnchoredSimple_typeBit_typeClass_type_expandedClass_typeType0TypeLoop_body1Loop_body0Loop_bodyDebug_keys1Debug_keys0Debug_keysRetryDebugCheckLoopMulti_branchConditionalRev_assignAssignCall_instructCreationInstruction0InstructionConst_attrValIntervalChoiceChoices1Choices0ChoicesWhen_part1When_part0When_partWhen_part_list1When_part_list0When_part_listThen_partThen_part_list1Then_part_list0Then_part_listCompound1Compound0CompoundConstraint1Constraint0ConstraintFormal_genericFormal_generic_list1Formal_generic_list0Formal_generic_listFormal_generics1Formal_generics0Formal_genericsEntity_decl_groupDeferredExternalOnce_bodyDo_bodyInternalEffectiveRoutine_body0Routine_bodyFormal_arg_list1Formal_arg_list0Formal_arg_listFormal_args1Formal_args0Formal_argsFeature_list1Feature_list0AllFeature_listNew_export_itemNew_export_list1New_export_list0New_export_listOp_nameInfixPrefixOpIdent_nameFrozenFeature_nameNew_feature_list1New_feature_list0New_feature_listCreation_clauseCreators1Creators0CreatorsRename_pairRename_list1Rename_list0Rename_listFeature_adaptation1Feature_adaptation0Feature_adaptationParentParent_list1Parent_list0Parent_listLocal_decls_list1Local_decls_list0Local_decls_listRescue1Rescue0RescueLocal_decls1Local_decls0Local_declsRoutineUniqueConstantAttributeFeatureDeclaration_bodyFeature_declFeature_decls1Feature_decls0Feature_declsClients2Clients1Clients0ClientsFeature_clauseFeatures1Features0FeaturesDeferred_classExpanded_classClassClass_header0Class_headerSimple_index_clauseTagged_index_clauseIndex_clauseIndex_list1Index_list0Index_listIndexing1Indexing0IndexingClass_comment1Class_comment0Class_commentClass_declarationClasses1Classes0ClassesEiffelNoTree  ! !"#(%&'(+*+.-.1014345878;:;<?>?@CBCIEFIHIJMLMNRPQRUTUXWX`Z_^]^_`adcdgfghkjknmnqpqrutuxwx{z{}~ ̮%s %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%s%*cTree: error in GetTree %hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*ccdbchan == -1classlib.c%s:%u: failed assertion `%s' %s%cinfo%s: Not an Eon/Eiffel database. Can't open database `%s'classesFailed to open `Classes' table clustersFailed to open `Clusters' table featuresFailed to open `Features' table parametersFailed to open `Parameters' table suppliersFailed to open `Suppliers' table ancestorsFailed to open `Ancestors' table genericsFailed to open `Generics' table visibilityFailed to open `Visibility' table assertionsFailed to open `Assertions' table cdbchan > -1classlib.c%s:%u: failed assertion `%s' ..........********clusterclustercluster_idcluster_idClass: %s Unable to insert cluster "%s" for class "%s" EDclass_idFailed to delete class entries (error %d) cluster_idclass_nameclass_idclass_idclass_name %s REIversionclass_idclass_idfeaturecodeclass_idfeaturecodefeature_classclass_idfeatureFailed to delete feature entries (error %d) feature_classcodeclass_idfeatureclass_iddas_delete ( Features) failed featureclass_idclientfeatureclass_idclass_iddas_delete ( Visibility) failed Failed to delete visibility entries (error %d) cdb_supplier_insert: class #%d could not be found class_idFailed to delete supplier entries (error %d) supprec->class_id > 0classlib.c%s:%u: failed assertion `%s' supprec->supplier != (char*)0classlib.c%s:%u: failed assertion `%s' strlen ( supprec->supplier) > 0classlib.c%s:%u: failed assertion `%s' class_idsupplierclass_iddas_delete ( Suppliers) failed class_idclass_idgeneric_paramclass_idgeneric_paramFailed to delete generic entries (error %d) class_iddas_delete ( Generics) failed cdb_parameter_insert: class #%d could not be found featureclass_idnamefeatureclass_idnamefeatureclass_idclass_iddas_delete ( Parameters) failed Failed to delete parameter entries (error %d) featuretypeclass_idcdb_assertion_insert: class #%d could not be found typefeatureclass_idFailed to delete assertion entries (error %d) class_iddas_delete ( Assertions) failed cannot determine ancestry of unknown class "%d" class_idclass_idancestorFailed to delete ancestor entries (error %d) class_iddas_delete ( Ancestors) failed code == 'R' || code == 'F'classlib.c%s:%u: failed assertion `%s' code == 'U' || code == 'C' || code == 'A'classlib.c%s:%u: failed assertion `%s' DecNovOctSepAugJulJunMayAprMarFebJan SatFriThuWedTueMonSun%02d:%02d:%02d %s %2d 19%2d%02d:%02d:%02d %s %s %2d 19%2d%s %2d %02d:%02d*** Memory allocation failure in `set_varfield1' (%d bytes) Showing keys for table "%s": Currrent key list empty Field = "%s" Direction = ?? Type = Unique Non-unique (end / none) Unknown (%d) ANDOR Conjunction = %s Value = (0x%x) %d %f "%s" Unknown (%d) (empty) ----- *** Memory allocation failure in `set_varfield2' (%d bytes) in %s, table = "%s" %d.%d.%d.%d%d.%d.%d.%dEON/Eiffel. (c) Eon Software 1993 All rights reserved Version %d.%d.%d.%d (patch level %d) EON/Eiffel. (c) Eon Software 1993. Version %d.%d.%d.%d (patch level %d) }.e%s.e%sIn file: %s r%s(%d): ^ At end of file. . . . Compiler Error! Contact EON Support. . . -%d%s%s %s %s %s %d %d %s %c *** Terminated *** Freeing at zero!!! Memory allocation errorTMPTMPDIREON_TMP/tmp%s/%s.XXXXXX%s.XXXXXX%*.*s%s000000(#*DAT*4#@#H#%s: (%d) %s Too many databasesdi_open_dbNo memory for db namedi_open_db%s%c%sdatabases is closeddi_open_tableNo memory for table structuredi_open_tablecould not look-up file namedi_open_tablecould not open tabledi_open_tableunable to look-up index-file namedi_open_tableunable to bt_open/RO index-filedi_open_tabledatabases is closeddi_open_tableerror finding key in index-filedi_match_startunable allocate space for index-setdi_retrieve_setunable to read header in ib-clusterdi_match_startselect * from %s where %s = "%s" (unique) where %s = "%s" (non-unique) Unimplemented key typeKeyAddressUnimplemented key typeKeyAddressUnimplemented key typeKeyEmpty%u%d%d%ld%fUnimplemented key typeKeyDataWarning: key not in indexdi_find_uniquelocked record encountereddi_retrieve_setunable to read header in ib-clusterdi_retrieve_setunable allocate space for index-setdi_retrieve_setunable to read exising INDEX in ib-clusterdi_retrieve_setunknown read-flagdi_read_reclocked record encountereddi_read_recerror in `store_read'di_read_recread record size mis-matchdi_read_reccould not read extensiondi_read_recordunknown direction flagdi_traversetable has no indexed fieldsdi_traverseunable to allocate space for index setdi_traverseunable to expand index setdi_traverseunable to expand index set (key != unique)di_traverseunable to expand index set(2)di_traverseNo record has been selecteddi_delete_recordAttempt to deleted unselected recorddi_delete_recordcould not free store recorddi_delete_recordNo record to deletedi_delete_dupserror in index filedi_delete_dupsindex entry missingdi_delete_dupsUnable to read index cluster headerdi_delete_dupscould not delete recorddi_delete_dupscould not free store recorddi_delete_dupsUnable to read index clusterdi_delete_dupsCouldn't find key in clusterdi_delete_dupsCouldn't re-allocate for new cluster. di_delete_dupsCouldn't free old cluster. di_delete_dupsCouldn't re-insert new cluster.di_delete_dupscould not delete recorddi_delete_uniqueNo record to deletedi_delete_dupscould not free store recorddi_write_recordcould not allocate store recorddi_write_recordcould not write to storedi_write_recordcould not write to storedi_write_record(key exists?) Unable to insert into index %s'%s'di_insert_uniqueNo record to deletedi_delete_dupserror in bt_find index-filedi_insert_dupscould not create new INDEX clusterdi_insert_dupsunable to read exising INDEX cluster headerdi_insert_dupscould not allocate temp set spacedi_insert_dupsunable to read exising INDEX clusterdi_insert_dupscould not write swapped INDEX clusterdi_insert_dupsCouldn't free old index. di_insert_dupsunable to re-allocate a larger INDEX clusterdi_insert_dupscould not insert re-allocated INDEX clusterdi_insert_dupsNo memory for 000000 namedi_newdir%s%c%scannot access (existing) database dirdi_newdircould not create database directorydi_newdirobject exists and is not a directorydi_newdircould not change perms on existing databasedi_newdircould not allocate new file-namedi_newindex%s!%s%s%c%scould not open/create index filedi_newindexa+could not open database 000000 filedi_newindex%s %s %s could not generate new data-file namedi_newtable%s%c%scould not store_open (create) new data-filedi_newtable%s|%d|%d %s|%d|%d|%d could not write to schema to storedi_newtablecould not write to schema size to storedi_newtablea+cannot access database directory filedi_newtable%s %s %s error creating index on tabledi_newtablestore label record baddi_getschemaunable to read schema record sizedi_getschemaunable to read schema recorddi_getschemaerror copying header from schemadi_getschema%[^|]|%d|%d error copying header from schemadi_getschema%[^|]|%d|%d|%d error scanning in field descriptiondi_getschemar%s!%s%X %*s %*s %X %06Xerror in DI routine "%s": %s rcould not open 000000 filedi_read_dir0.tmpwcould not open 0.tmp filedi_read_dirrcould not open 000000 filedi_read_dir%s %s %s %s%c%sLocked - waiting. |33A serious error occured while the database was being processed. %s: (%d) %s Failed to open databasedas_open_dbEON_NOLOCKTable does not existdas_openFailed to open tabledas_openFailed to close tabledas_openFailed to delete tabledas_delete_tableNo memorydas_makekeySingle field onlydas_seekFailed lookup field namedas_seekdas_seekError reading recorddas_read Error %d: %s Extra information: Error %d: %s Error from STORE routine Operation system message: %s. Error %d from `das' routine "%s": %s Error %d from DI routine "%s": %s Error from STORE routineOperation system message: %s. Failed to get current directory namedas_fullnameFailed to change to database directorydas_fullnameFailed to get database directory namedas_fullnameNo memorydas_fullname%s/%sDatabase does not existdas_fullnameNo read permissiondas_fullnameNo write permissiondas_fullnameCan't return to local directorydas_fullnameOut of memory. %s: set is void s%s: set has %d item%s: [|%s%d] unable to allocate space for %d set-items $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stalloc.c,v 1.1 89/10/24 10:09:12 mjr Rel $7FREE LIST DUMP %x %d: SIZE %d ADDR %x NO FREE LIST $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stclose.c,v 1.1 89/10/24 10:09:13 mjr Rel $t8$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/sterrs.c,v 1.1 89/10/24 10:09:14 mjr Rel $89}9l9]9L9record too smallno such recordrecord I/O errorbad record headerno record errorcannot open9%s 9%s: %s 9$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stfree.c,v 1.1 89/10/24 10:09:14 mjr Rel $9$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stgethed.c,v 1.1 89/10/24 10:09:15 mjr Rel $$:$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stopen.c,v 1.1 89/10/24 10:09:16 mjr Rel $:$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stputhed.c,v 1.1 89/10/24 10:09:17 mjr Rel $:$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stread.c,v 1.1 89/10/24 10:09:17 mjr Rel $H;$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stunlink.c,v 1.1 89/10/24 10:09:18 mjr Rel $;$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwrite.c,v 1.1 89/10/24 10:09:19 mjr Rel $<$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwsuper.c,v 1.1 89/10/24 10:09:19 mjr Rel $h<$Header: /atreus/mjr/hacks/btree/btlib/RCS/btclose.c,v 1.1 89/10/24 10:08:55 mjr Rel $<$Header: /atreus/mjr/hacks/btree/btlib/RCS/btdelete.c,v 1.1 89/10/24 10:08:56 mjr Rel $$=$Header: /atreus/mjr/hacks/btree/btlib/RCS/btfind.c,v 1.1 89/10/24 10:08:57 mjr Rel $=$Header: /atreus/mjr/hacks/btree/btlib/RCS/btgoto.c,v 1.1 89/10/24 10:08:58 mjr Rel $=$Header: /atreus/mjr/hacks/btree/btlib/RCS/btinsert.c,v 1.1 89/10/24 10:08:58 mjr Rel $8>$Header: /atreus/mjr/hacks/btree/btlib/RCS/btio.c,v 1.1 89/10/24 10:08:59 mjr Rel $>$Header: /atreus/mjr/hacks/btree/btlib/RCS/btoopen.c,v 1.1 89/10/24 10:09:01 mjr Rel $>$Header: /atreus/mjr/hacks/btree/btlib/RCS/btopen.c,v 1.1 89/10/24 10:09:00 mjr Rel $H?$Header: /atreus/mjr/hacks/b+tree/btlib/RCS/btpage1.c,v 1.1 89/10/24 10:09:02 mjr Rel $?$Header: /atreus/mjr/hacks/btree/btlib/RCS/btpage2.c,v 1.1 89/10/24 10:09:05 mjr Rel $@$Header: /atreus/mjr/hacks/btree/btlib/RCS/btravrs.c,v 1.1 89/10/24 10:09:06 mjr Rel $\@$Header: /atreus/mjr/hacks/btree/btlib/RCS/btseek.c,v 1.1 89/10/24 10:09:06 mjr Rel $@$Header: /atreus/mjr/hacks/btree/btlib/RCS/btzap.c,v 1.1 89/10/24 10:09:06 mjr Rel $ASeek errorRecord locking deadlock$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stcopy.c,v 1.1 89/10/24 10:09:13 mjr Rel $A$Header: /atreus/mjr/hacks/btree/btlib/RCS/btlabel.c,v 1.1 89/10/24 10:08:59 mjr Rel $A$Id: System.c,v 1.8 1992/09/24 14:20:40 grosch rel $rrb$Id: General.c,v 1.5 1992/05/05 13:19:05 grosch rel $$Id: Memory.c,v 1.13 1992/06/24 12:23:15 grosch rel $$Id: DynArray.c,v 1.6 1992/08/17 11:42:24 grosch rel $MakeArray: out of memory ExtendArray: out of memory $Id: StringMem.c,v 1.11 1992/05/05 13:19:05 grosch rel $%8x %5ld Bytes $Id: Idents.c,v 1.12 1992/05/05 13:19:05 grosch rel $EE%5d %5d%5d Idents = %5d gd n ``/g?`0$hgp`eon3122/bin/ep3000755 000000 000001 00000762004 05710535133 013464 0ustar00rootother000000 000000 dppgb-̀\ `D$4 ``PXcc?:P`[̀UjK]ÐUVSu] T9}SpRV `3e[^]ÐU=<u!<%<H <<]ÐUWVSE1EEE=_u*hh@jJ0 =_u EU:_t];t;_uEC;u9]sKN;_u7Uu9]uhhV-P/ 1w< v8;.u#E}thhl-P/ E1N+N}t Guhh-Ph/ KE9]L}t}uhh-P5/Fe[^_]ÐU,WVSf=,$E܋0p Cf99ufyf Kft$ 0I> u   $FB9}>uSpPhp;`ƃp Ktp: t<wJKuƃqhpEPR/E@EDEHELf fXfpf+$fZf fXfpf+$fZwf fXfpf+$fZGf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZWf fXfpf+$fZ'f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZgf fXfpf+$fZ7f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZwf fXfpf+$fZGf fXfpf+$fZf fXfpf+$fZ8f fXfpf+$fZf fXfpf+$fZwf fXfpf+$fZGf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZWf fXfpf+$fZ'f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZgf fXfpf+$fZ7f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZwf fXfpf+$fZGf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZWf fXfpf+$fZ'f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZgf fXfpf+$fZ7f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZwf fXfpf+$fZGf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZWf fXfpf+$fZ'f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZf fXfpf+$fZgf fXfpf+$fZ7f fXfpf+$fZf fXfpf+$fZf fXfpf+$fZ>f fXfpf+$fZ<wf fXfpf+$fZ=Gf fXfpf+$fZ}f fXfpf+$fZ=8~ 8) f fXfpf+$fZ: f fXfpf+$fZ,w f fXfpf+$fZ.G f fXfpf+$fZ{ f fXfpf+$fZ8( f fXfpf+$fZ=8oЃ u 0H$;t݃ t؍Bv 00;m f fXfpf+$fZ!7 f fXfpf+$fZ/ f fXfpf+$fZ* f fXfpf+$fZ- f fXfpf+$fZ+w f fXfpf+$fZhhBj jhx_mEԃ9~hhj" j jhE_ 00 f fXfpf+$fZ% f fXfpf+$fZ' f fXfpf+$fZ]W f fXfpf+$fZ[' f fXfpf+$fZ@ f fXfpf+$fZ^ f fXfpf+$fZ$ f fXfpf+$fZ\g f fXfpf+$fZ~7 f fXfpf+$fZ` f fXfpf+$fZ#f fXfpf+$fZ|f fXfpf+$fZhhrhEPE`EdEhEl:f fXfpf+$fZhhhEPE`EdEhElhhP7f fXfpf+$fZhhjEPEPBE`EdEhElD0fTf fXfpf+$fZhhj|EPEPcE`EdEhElf fXfpf+$fZhhhEPE`EdEhElZf fXfpf+$fZhh"='u6hEP\E`EdEhE4EhP&E`EdEhElf fXfpf+$fZ"/؃"-=%u|%F؃ t CN؃ u 0H$ tݍCvՃ%thh-P i u% 0H$hhj ؈F("FEhPE`EdEhElQf fXfpf+$fZp 0H$ f fXfpf+$fZf fXfpf+$fZhhhhj1C< tKpf=,$p+$EԸ+Eԃ)$EKf fXf+$fZC0 `9 `w CPh `_[ ` fK0f Tuf=,Efx90t&fhH.hbhhh `_pЋ]]UE ]ÐUE]ÐU]ÐUS]=uT=@tAhpHR'EhpP9USUS USUS@]]ÐUWVS=hp5V'p=p t =p u C; t; tC; t; t0ЃjhS(_ tjhS_ uq C; t; tڀ:t*: t%<v: tC;t; t <v; uhXRb_thh `_e[^_]ÐSz[zbzjzozvz~zzU(WVSEEؖDžSfDž)jEPEP#jEPEP#uE䉅M䉍u܉ƅ9ri+]+EܾjEPEP#jEPEP#]䉝E܉ME䉅ffh9Lf]pffuuBffE+EPMQuVEP[LM։ƅf6fVSPf<]BvWSPff=>wW XN `N dN hN lN'ƅ=pI$d/s$tssTwtTtttTsts4st7777UtvvvbUGFOd?w?RHdRRB$gtuuuDutuiijg$ggjkDT_^__D]]]$^t^STBT:t;rr;4<;6d7b4aaaatafdbVVTV<<H4OONNIJdKHxDQQ4PPJJDKGL4L>??$U4S4@tBhfmf4jTk4ik4jdjthdlltidctddcC4cC4cDdE[[D`XYY4Z4ZW\d\$XTW]\XY<``tSSTE4cETF@@tAAM78K$=t==6667d777777899:$:T::$;t;;;4<t<<<<<=$=t==>4>T>t>>?D?d????4@t@@@tAADBTBdBtBBBdCCCCD4DtDDDEdEEEE4FTFGFFFG4GGGHTHHHTItIIIJTJdJJJJJJKDKdKKKK4LtLLMMNN4OOOP4PdPPPDQQQRDRdRRR4StSSS$TTT$UdUUUVTVVVV4WTWWW$XdXXXX$YDYdYYY4ZY4ZtZZZD[[[$\d\\\]D]]]$^t^^_T____D````4ataaaabdbbbc4cdccc$dtddd4eeefTfff$gggg$hthhhh4i4jdjtiii4jdjjjkTkkk$ldllmdmmm$ndnnn$odooo$pdppp$qdqqqDrrrr4sTstssss$tTttttttuDutuuu4vtvvvTwww4xxjEPEPjEPEPCfDž6VcJPAfDžIQJ?fDžvVJP QvVJAfDžIQ2JP6VIQYJEhyFPFPT@fDž@쁅fDž=t QvV/IQَPVQvxVI`QvHVI0QvV Q=H(fDž=t5VIQovVPQjvxVI`QvHVI0QvV Q=Ht*5PVIQ!vV艍PIQHE, ?fDžh fDžh{ fDžvVI<fDžIQI<fDž=(t 50VIQҌvVyPIQvV\I=fDžIQIP6VIQI[=fDžvVbIP QvVI =fDžI0Q6VIQ?I =fDžvV QvVH<fDžI0Q6VIQOI<fDž6VIQiI;fDžvV`i:fDžfDž $fDž#fDž#fDžIQ@I9fDžv0VIQHIEhXF@fDžIHQvVIEhXAXNfDžvHVIQHEhXFXP<:fDžh@KfDžh@+fDžh@ fDžIQ2IPvVIQXI9fDžv0VIQvVI9fDžIQ6VIQI{9fDžvVI7fDžIQIk7fDžvVIQIV8fDžvVJ 7fDžIQ6VIQJ8fDžvV QvVJK8fDž<8fDžIHQv0V Q=:fDžvVrJPI0Q6V=t QvVIQɅPvVvIfDžIQvVhPfDžjvVhP Q=t"5VIQTvVPIQHfDžfDž fDžfDžvVIQIv5fDžvV2I4(fDžQVIxQv`VIHQv0VIQHEi5fDžhD5fDžfDžIQvVhjV4fDžI0QvVxj4fDžIQH2fDžvV2JPIQHN4fDžvVIQHv3fDžhyF6PF4KfDžhyA6PA4fDžvVRIP QvVyI3fDžIQ6VIQ/I3fDžkfDžIQvV(i62fDžI0QvV8i1fDžIQpG0fDžvVIQxG1fDž fDž fDžIQbH/fDžvV2H/fDžIQHP6VIQ)H0fDžvVGP QvVG0fDžIQ6VIQG0fDžv0V QvVOGk0fDžIQHP6VIQYG/fDžvV QvVG/pfDžI`QvHVI0QvV QvV~GEz/fDžIQG-fDžvVG[-fDžfDžvVrGP QvVGk.fDžI0Q6VIQOGk.fDžfDžfDž;fDž|fDž0fDž[fDžvVL+fDžIQL+fDž{fDžI0Q6VIQOF-fDžvVF9+fDžfDž vVrFPIQvVFJ,fDž I0QvVIQNFJ,fDž vVbKP QvVYF+fDž IQ6VIQF+fDžvVrFP=t QvVzIQyP6VIQ]FAfDžv0V=t& QvVyIQ9yP6VIQEo*fDž =@||SFP hSƿ_u#Q5HVIQxP QvVxPIQ.6VIQ`xPvVEE :)fDž IQvVxPIQUE)fDž vVIQwPvVEFA)fDž IQvVhwPIQE(fDž vVIQF(fDžvVpF&fDžIMg(fDž vVFP QvV9F'fDž I0Q6VIQE'fDžvVFP QvVE;'fDžIQ6VIQE;'fDžvVRFP QvVyF&fDžI0Q6VIQ/F&fDžvVE$fDžIQpF$fDžvVGPIQrF&fDžvVIQ8FF%fDžvVFP QvVFK%fDžI0Q6VIQoFK%fDžvVIQGv$fDžvVIQG6$fDžvVH"fDžIQqPv(VIQpPvVUG#fDžI0Qv(VIQ>pPvVF#fDžI(QvVo#fDžI0Q6VIQF[#fDžvVpGy!fDžIQvVxGf"fDžIQGPvV2G"fDžIQGP6VIQG+"fDžv0V QvVoG+"fDžIQ6VIQG!fDžvVG fDžIQvVG fDžIQ`HfDžvV QvV_H+!fDžIQHP6VIQH fDžv0V QvVH fDžI0Q6VIQH[ fDžvV IyfDžI0QvVIQIfDžvVIfDžI`QvVIQIfDžfDžgfDžvVIP QvVIfDžI0Q6VIQIfDžv0V QvVIfDžI0Q6VIQIKfDž6VIQIwfDž6VIQI7fDžvVXPI0QvVHOPEfDžvVWPIHQvVIQI2fDžv`VI0QvVNP8pfDžvxVIHQvVIQaISfDž6VIQyIfDžv0V QvVIfDžh z^fDžv0V QvVIfDžh/zAPAPfDžvVBBPIQvV8IfDžIHQvVIQHfDžvVAPI0QvVIQHpfDžv`VI0QvVIQHpfDžv`VIHQv0VIQvVHEfDžIQvVHfDžIQ6VIQHkfDžvVH{fDž$I0MfDž$vVIfDž%IQHPvVIQdPvVH7fDž%I0QvVIQ~dPvVH'fDž!IQL9fDž!vufDž"IHQvVIQHfDžvVIQJfDžfDž QvVIWfDžIQvVXIfDžIQFPNQCdPvVfHbfDžI0QF(PNQcPvVfHfDž&IQI)fDž&vVIQIfDžvV0JfDž Qj^fDž Qj.fDž QjvVIfDž#IQKP6VIQL[fDž#vVKP QvVK fDž#I0Q6VIQK fDž#vV QvV?KfDž( QvV`PfDž(vVPP QvVKfDž(I0Q6VIQ?KfDž'vVKP QvVKkfDž'I0Q6VIQKkfDž)vVKP QvV LfDž)I0Q6VIQKfDžvV QvVOLfDžIQLPvVIQ]PvVKfDž*IQ`LYfDž*vVMPIQbLfDž*vVIQ(LfDž+vVLP QvVL fDž+I0Q6VIQ_L fDž {fDž fDž vVIQxLfDž6VIQYMfDžvVIQNvfDžv0VIQO6fDžvVUPIQNfDž6uhfDž M8fDžvVJPIQM fDžvVIQHM fDž-vVIQL fDž6VIQJPvVvK" fDžI0QvVIQ.K fDž.vVIQhMfDž.IQvVhMHfDž.vVIQvVMPIQJ fDž.vVIQMPvVJ fDž/I0Q6VI(QvV%MfDž/v0V QvVN{fDž/v0V QvVoM;fDž/v0V QvVoMfDž/v0V QvVLfDž/v0V QvV/L{fDž/v0V QvVL;fDž/v0V QvVLfDž/v0V QvV/MfDž/v0V QvV/M{fDž/v0V QvV/M;fDž/v0V QvV/MfDž/v0V QvV/MfDž/v0V QvV/M{fDž/v0V QvV/M;fDž/v0V QvV/MfDž/v0V QvV/MfDž/v0V QvV/M~fDž/v0V QvV/M>fDž/v0V QvV/MPIQ,E>fDžvVbMP QvVMfDžfDžv0V QvVMfDžI0Q6VIQfDžfDžfDžfDžF(PhNfDžF($fDžv({fDžv,v(fDžfDž;fDž[fDž{fDž,vVIQ(LfDž,vVBLfDž,IQRLfDž,vVhIQSLfDž,vvhNQgLfDž,vVIQNfDž,vVIQNfDžFPNQ{fDžvVBO.fDžIQROEhhzS膖_SFPFPԺfDž|+ hAPh 1ۃ|t^|VhN_GC|u1fDžAPqVmNEfDžIQrGP6VIQGEHfDžv0V QvVGE lfPfE5Xq5`q5dq 5hq5lqf45Xq5`q5dq 5hq5lq踈ƅβff[^_]ÐU4WVSfEfDž5XVjj迴h]SESPuVE P{ƅ$P4ÃugVOfD׈щ#RVR_hzVG_느Pj5XVjjǵEPh]Sd SVEPu VW0ۃEf0ffE≕|?Ðfuffffu≕}ƍEP)tXPjj/[^_]ÐUWVSf}NjUfBfEUR1ۃVEPft)PU RURV,tPURfCfve[^_]ÐUWVSfMfMfujMMQMMQލ]PM QMQr_ EfwjMQMQVsftfBqf)UpPދEXPǃ9]wjMQMQU fFfEfwfGf4EBvfuMQhjE PEPSfBqf)UpP׋EPP9fGf3땐fG%e[^_]ÐUSf]fU fw=ˉhf9tfMpfu1&BÁlP]]ÐU]ÐU]ÐUVS]1C9CwS蒁_tCCptF͐e[^]ÐUVSu1ۍEPhzV_ 9]v:F9FwV*_tFFpC9]wƃpe[^]ÐUj ]ÐUWVS5zf=zuE z|fffHf#ff9zvfzfz9~hPWzPzz)׉PzzPe[^_]ÐUSf]z9zw5EzzffBЋ]]UUfE 1Ʌtf9r%ff9Eȉȉ]ÐUz9zwzzffBMJЉ]ÐUz9zwzzzffBMJЉ]ÐUz9zw:zzffBMJЉ]ÐUz9zwzzffBMJM JMJ Љ]ÐUz9zwzzffBMJM JMJ MJMJMJM JM$J M(J$M,J(M0J,Љ]ÐUz9zw*zzffBMJЉ]ÐUz9zwzzffBMJЉ]ÐUz9zwzzffBMJM JЉ]ÐUz9zwZzzf fBMJЉ]ÐUz9zwzzf fBMJЉ]ÐUz9zw{zf fBMJM JMJ Љ]ÐUz9zw{zf fBMJЉ]ÐUz9zwJ{zf fBMJЉ]ÐUz9zw {zffBMJM JMJ Љ]ÐUz9zw{zffBMJЉ]ÐUz9zwz {zffBMJM JMJ Љ]ÐUz9zw* {zffBMJM JЉ]ÐUz9zw{zffBMJЉ]ÐUz9zw{zffBMJЉ]ÐUz9zwZ{zffBMJM JЉ]ÐUz9zw {zffBMJM JЉ]ÐUz9zw{zffBMJM JЉ]ÐUz9zwj{zffBMJЉ]ÐUz9zw*{zffBMJЉ]ÐUz9zw{zffBMJM JMJ Љ]ÐUz9zw{zffBMJM JMJ Љ]ÐUz9zwJ {zffBMJЉ]ÐUz9zw "{zffBMJЉ]ÐUz9zw${zffBMJЉ]ÐUz9zw&{zffBMJM JЉ]ÐUz9zw:({zffBMJЉ]ÐUz9zw*{zf fBMJЉ]ÐUz9zw,{zf!fBMJM JMJ Љ]ÐUz9zwj.{zf"fBMJM JMJ Љ]ÐUz9zw0{zf#fBMJM JMJ MJMJЉ]ÐUz9zw2{zf$fBMJЉ]ÐUz9zwz4{zf%fBMJЉ]ÐUz9zw:6{zf&fBMJM JЉ]ÐUz9zw8{zf'fBMJЉ]ÐUz9zw:{zf(fBMJM JMJ MJMJMJM JЉ]Uz9zwJ<{zf)fBMJЉ]ÐUz9zw >{zf*fBMJЉ]ÐUz9zw@{zf+fBMJM JЉ]ÐUz9zwzB{zf,fBMJЉ]ÐUz9zw:D{zf-fBMJЉ]ÐUz9zwF{zf.fBMJM JЉ]ÐUz9zwH{zf/fBMJЉ]ÐUz9zwjJ{zf0fBMJЉ]ÐUz9zw*L{zf1fBMJM JMJ Љ]ÐUz9zwN{zf2fBMJЉ]ÐUz9zwP{zf3fBMJЉ]ÐUz9zwZR{zf4fBMJM JMJ Љ]ÐUz9zw T{zf5fBMJM JMJ Љ]ÐUz9zwV{zf6fBMJЉ]ÐUz9zwzX{zf7fBMJЉ]ÐUz9zw:Z{zf8fBMJM JMJ MJMJMJЉ]ÐUz9zw\{zf9fBMJЉ]ÐUz9zw^{zf:fBMJЉ]ÐUz9zwZ`{zf;fBMJM JMJ Љ]ÐUz9zw b{zf<fBMJM JMJ Љ]ÐUz9zwd{zf=fBMJЉ]ÐUz9zwzf{zf>fBMJЉ]ÐUz9zw:h{zf?fBMJM JMJ Љ]ÐUz9zwj{zf@fBMJM JMJ Љ]ÐUz9zwl{zfAfBMJЉ]ÐUz9zwZn{zfBfBMJЉ]ÐUz9zwp{zfCfBMJM JMJ MJЉ]ÐUz9zwr{zfDfBMJM JЉ]ÐUz9zwzt{zfEfBMJM JMJ Љ]ÐUz9zw*v{zfFfBMJM JMJ Љ]ÐUz9zwx{zfGfBMJM JЉ]ÐUz9zwz{zfHfBMJM JMJ Љ]ÐUz9zw:|{zfIfBMJM JMJ Љ]ÐUz9zw~{zfJfBMJM JЉ]ÐUz9zw{zfKfBMJЉ]ÐUz9zwZ{zfLfBMJЉ]ÐUz9zw{zfMfBMJM JMJ Љ]ÐUz9zw{zfNfBMJM JMJ Љ]ÐUz9zwz{zfOfBMJЉ]ÐUz9zw:{zfPfBMJЉ]ÐUz9zw{zfQfBMJЉ]ÐUz9zw{zfRfBMJM JMJ Љ]ÐUz9zwj{zfSfBMJЉ]ÐUz9zw*{zfTfBMJЉ]ÐUz9zw{zfUfBMJM JЉ]ÐUz9zw{zfVfBMJЉ]ÐUz9zwZ{zfWfBMJЉ]ÐUz9zw{zfXfBMJM JMJ Љ]ÐUz9zw{zfYfBMJЉ]ÐUz9zw{zfZfBMJЉ]ÐUz9zwJ{zf[fBMJЉ]ÐUz9zw {zf\fBMJЉ]ÐUz9zw{zf]fBMJM JЉ]ÐUz9zwz{zf^fBMJM JЉ]ÐUz9zw*{zf_fBMJM JMJ Љ]ÐUz9zw{zf`fBMJЉ]ÐUz9zw{zfafBMJM JMJ Љ]ÐUz9zwJ{zfbfBMJЉ]ÐUz9zw {zfcfBMJЉ]ÐUz9zw{zfdfBMJM JЉ]ÐUz9zwz{zfefBMJЉ]ÐUz9zw:{zfffBMJЉ]ÐUz9zw{zfgfBMJM JMJ Љ]ÐUz9zw{zfhfBMJM JMJ Љ]ÐUz9zwZ{zfifBMJЉ]ÐUz9zw{zfjfBMJЉ]ÐUz9zw{zfkfBMJM JЉ]ÐUz9zw{zflfBMJЉ]ÐUz9zwJ{zfmfBMJЉ]ÐUz9zw {zfnfBMJM JMJ Љ]ÐUz9zw{zfofBMJЉ]ÐUz9zwz{zfpfBMJЉ]ÐUz9zw:{zfqfBMJM JMJ Љ]ÐUz9zw{zfrfBMJM JMJ Љ]ÐUz9zw{zfsfBMJЉ]ÐUz9zwZ{zftfBMJЉ]ÐUz9zw{zfufBMJM JMJ Љ]ÐUz9zw{zfvfBMJЉ]ÐUz9zw{zfwfBMJЉ]ÐUz9zwJ{zfxfBMJM JMJ Љ]ÐUz9zw{zfyfBMJЉ]ÐUz9zw{zfzfBMJЉ]ÐUz9zwz{zf{fBMJM JMJ Љ]ÐUz9zw*{zf|fBMJЉ]ÐUz9zw{zf}fBMJM JMJ Љ]ÐUz9zw{zf~fBMJM JЉ]ÐUz9zwJ{zffBMJM JЉ]ÐUz9zw{zffBMJЉ]ÐUz9zw{zffBMJЉ]ÐUz9zwz{zffBMJM JMJ MJЉ]ÐUz9zw*{zffBMJM JЉ]ÐUz9zw{zffBMJM JMJ Љ]ÐUz9zw{zffBMJM JMJ Љ]ÐUz9zw:{zffBMJM JMJ Љ]ÐUz9zw{zffBMJM JMJ MJЉ]ÐUz9zw{zffBMJM JMJ MJMJЉ]ÐUz9zw:{zffBMJM JЉ]ÐUz9zw{zffBMJM JMJ Љ]ÐUz9zw|zffBMJЉ]ÐUz9zwZ|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zw|zffBMJM JMJ Љ]ÐUz9zw|zffBMJЉ]ÐUz9zwJ |zffBMJЉ]ÐUz9zw  |zffBMJM JMJ Љ]ÐUz9zw|zffBMJЉ]ÐUz9zwz|zffBMJЉ]ÐUz9zw:|zffBMJM JMJ Љ]ÐUz9zw|zffBMJM JMJ Љ]ÐUz9zw|zffBMJM JЉ]ÐUz9zwJ|zffBMJM JЉ]ÐUz9zw|zffBMJM JЉ]ÐUz9zw|zffBMJЉ]ÐUz9zwj|zffBMJЉ]ÐUz9zw* |zffBMJM JЉ]ÐUz9zw"|zffBMJЉ]ÐUz9zw$|zffBMJЉ]ÐUz9zwZ&|zffBMJM JMJ Љ]ÐUz9zw (|zffBMJЉ]ÐUz9zw*|zffBMJM JЉ]ÐUz9zwz,|zffBMJM JЉ]ÐUz9zw*.|zffBMJЉ]ÐUz9zw0|zffBMJM JЉ]ÐUz9zw2|zffBMJM JЉ]ÐUz9zwJ4|zffBMJЉ]ÐUz9zw 6|zffBMJЉ]ÐUz9zw8|zffBMJM JMJ Љ]ÐUz9zwz:|zffBMJЉ]ÐUz9zw:<|zffBMJЉ]ÐUz9zw>|zffBMJM JMJ Љ]ÐUz9zw@|zffBMJЉ]ÐUz9zwjB|zffBMJЉ]ÐUz9zw*D|zffBMJM JMJ Љ]ÐUz9zwF|zffBMJЉ]ÐUz9zwH|zffBMJЉ]ÐUz9zwZJ|zffBMJM JMJ Љ]ÐUz9zw L|zffBMJЉ]ÐUz9zwN|zffBMJЉ]ÐUz9zwP|zffBMJM JMJ Љ]ÐUz9zw:R|zffBMJЉ]ÐUz9zwT|zffBMJЉ]ÐUz9zwV|zffBMJM JЉ]ÐUz9zwjX|zffBMJЉ]ÐUz9zw*Z|zffBMJЉ]ÐUz9zw\|zffBMJM JMJ Љ]ÐUz9zw^|zffBMJЉ]ÐUz9zwZ`|zffBMJM JЉ]ÐUz9zw b|zffBMJЉ]ÐUz9zwd|zffBMJЉ]ÐUz9zwf|zffBMJM JЉ]ÐUz9zw:h|zffBMJM JЉ]ÐUz9zwj|zffBMJM JMJ Љ]ÐUz9zwl|zffBMJM JMJ MJЉ]ÐUz9zwJn|zffBMJM JMJ Љ]ÐUz9zwp|zffBMJM JЉ]ÐUz9zwr|zffBMJM JЉ]ÐUz9zwZt|zffBMJM JЉ]ÐUz9zw v|zffBMJM JЉ]ÐUz9zwx|zffBMJЉ]ÐUz9zwzz|zffBMJЉ]ÐUz9zw:||zffBMJЉ]ÐUz9zw~|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zwz|zffBMJM JЉ]ÐUz9zw*|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zwj|zffBMJЉ]ÐUz9zw*|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zwj|zffBMJЉ]ÐUz9zw*|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zwj|zffBMJЉ]ÐUz9zw*|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zwj|zffBMJЉ]ÐUz9zw*|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zwj|zffBMJЉ]ÐUz9zw*|zffBMJЉ]ÐUz9zw|zffBMJM JMJ Љ]ÐUz9zw蚿|zffBMJM JMJ Љ]ÐUz9zwJ|zffBMJЉ]ÐUz9zw |zffBMJЉ]ÐUz9zwʾ|zffBMJM JЉ]ÐUz9zwz|zffBMJЉ]ÐUz9zw:|zffBMJЉ]ÐUz9zw|zffBMJM JMJ Љ]ÐUSz9zw詽|zffB]ZM JM]J ZЋ]]ÐUz9zwJ|zffBMJЉ]ÐUz9zw |zffBMJЉ]ÐUz9zwʼ|zffBMJЉ]ÐUz9zw芼|zffBMJЉ]ÐUz9zwJ|zffBMJЉ]ÐUz9zw |zffBMJЉ]ÐUz9zwʻ|zffBMJЉ]ÐUz9zw芻|zffBMJЉ]ÐUz9zwJ|zffBMJM JЉ]ÐUz9zw|zffBMJM JЉ]ÐUz9zw誺|zffBMJЉ]ÐUz9zwj|zffBMJЉ]ÐUz9zw*|zffBMJЉ]ÐUz9zw|zffBMJЉ]ÐUz9zw誹|zffBMJЉ]ÐUSf] z9zwe|zffBMJfZЋ]]ÐUz9zw|zffBMJЉ]ÐUz9zwڸ|zffBMJЉ]ÐUz9zw蚸|zffBMJM JЉ]ÐUS]0fCf{!H=$|\,\[0SRS RSRSRSRSRS RS$R S(R[,SRS RSRSRSR[SRwS RnSReSR\[YSRGS R>SR5[ 2[ SRS R[[SR[ ]]ÐUS]9|(9u %J@9}9ujhh$]]ÐUTRU RjURk7_]ÐUSSEP葇Sh TR6_]ÐUS]u4TP9Pwh''f{uYTP9PwhPU2_@SfHjhHc'f{vYTP9PwhP1_@SDfHjhHjS|f;vITP9PwhP1_@jSb4TB9BwPRL1_ BfCH=j&$||l ,Ll ,Ll ,Ll ,LlLl ,Ll ,|<\|<\|<\|<\|<\|<\|<\|<\|<\|<\| ,Ll ,Ll ,Ll ,Ll ,Ll ,Ll ,Ll,Ll<\|<\|<\|<\|,Ll<\|\|,Ll[`CPCPh!CPCPh!CPCPh CPCPh) TQ0_KQK QKQKQ KQKQK QK$QK(Q[,~CPCPh2 CPCPh; CPCPhD TQ/_hp[S}hphM TQ/_TP9P CPCPhP; CPCPhY CPCPhb+CPCPhkCPCPhtCPCPh}CPCPh{CPCPhCPCPhCPCPhCPCPhCPCPh;CPCPhCPCPhŎCPCPhΎ{CPCPh׎[CPCPhkCPCPhKCPCPhCPCPhCPCPhCPCPh CPCPh{CPCPh[CPCPh(kCPCPh1KCPCPh:+ CPCPhCCPCPhLCPCPhUCPCPh^{CPCPhg TQ+_KQK QKQKQ KQ[CPCPhpCPCPhyCPCPhCPCPhCPCPh{CPCPhCPCPh;CPCPhCPCPh+CPCPhCPCPhʏCPCPhӏCPCPh܏CPCPh[CPCPh;CPCPh TQA)_KQK QKQzKQq[ nCPCPhCPCPh CPCPhCPCPhCPCPh$KCPCPh-+CPCPh6;CPCPh?CPCPhHCPCPhQCPCPhZ+CPCPhcCPCPhl{CPCPhu[CPCPh~kCPCPhCPCPhCPCPh TQ&_hp[Sthph CPCPhkCPCPhKCPCPh[CPCPh;CPCPhɐCPCPhҐCPCPhېCPCPhCPCPhkCPCPhKCPCPhCPCPh CPCPhCPCPhCPCPh#CPCPh,CPCPh5kCPCPh>KCPCPhG CPCPhPk CPCPhYCPCPhbCPCPhkCPCPhtCPCPh}kCPCPh CPCPh+CPCPh CPCPhCPCPhCPCPhCPCPhCPCPhő CPCPhΑKCPCPhב+CPCPh;CPCPhCPCPhCPCPhCPCPhCPCPh kCPCPhKCPCPh[CPCPh( CPCPh1CPCPh: CPCPhCCPCPhLCPCPhU CPCPh^KCPCPhg[ CPCPhpk CPCPhyK CPCPhCPCPhCPCPh+CPCPhCPCPh{ CPCPh[ CPCPh; CPCPhCPCPhʒ TQ_KQCPCPhCPCPh TQ_[CPCPhkCPCPh KCPCPh+CPCPh CPCPh%CPCPh. TQ_hp[Schph7+CPCPh:CPCPhCkCPCPhLKCPCPhU+CPCPh^ CPCPhgCPCPhpCPCPhyCPCPhCPCPhkCPCPhKCPCPh+CPCPh CPCPhCPCPhCPCPhCPCPhʕCPCPhӕkCPCPhܕKCPCPh+CPCPh CPCPhCPCPh TQ_KQ<[ 9CPCPh CPCPh{CPCPh TQ_hp[SG`hph$CPCPh'CPCPh0CPCPh9 TQ_jCPj.CPCPhB TQ_jCPjC PCPCPhKkCPCPhTKCPCPh]+CPCPhf CPCPhoCPCPhxCPCPhCPCPhCPCPh TQ_hp[SW^hphCPCPh TQQ_hp[S^hphCPCPhCPCPhCPCPhCPCPhƖCPCPhϖnCPCPhؖ TQq_CP{CPCPhCPCPh TQ!_iCPCPh TQ_hp[S\hph TQ_TP9PwjP _@]]ÐUS] ETff=u SSf ]]ÐUTRU RjUR[_]ÐUWVSuShTRE_0ЃPS]f[^_]ÐUWVS]TB9BwR _tTPf@ fP==t-=tY=t"&jhLL]&jhLjhPPPPSf9LtYh `h _zЃ>jhPDPPLj PP賈PH=%$,,<\|,Ll ,Ll ,Ll ,Ll ,Ll<\|<\|<\|<\|<\|<\|<\| < \ |      < \ |      < \ |      < \ |      < \ |     Ll ,Ll ,Ll,Ll ,Ll ,Ll ,Ll ,Ll ,\|<\|<\|<\|<\|,Ll ,Ll <\|PPh!PPh' PPh1[PPh;5TV_P PPP PP P$P(P,PPhE+ PPhO PPhY PPhcPPhmPPhw PPhkPPhKPPhPPh PPhkPPhPPhPPhǗPPhї;PPhۗPPhPPh PPhPPhKPPh +PPhPPh!kPPh+KPPh5PPh? PPhIPPhSKPPh]+PPhg+ PPhqkPPh{KPPhPPh PPh5TV/_P P PP PPPh{PPh[PPh PPhPPh˘PPh՘PPhߘPPhPPhPPh[PPh;PPhPPh{PPh%PPh/PPh95TV_P PPP PPhC;PPhMPPhW{PPha[PPhkPPhuPPhPPhPPh;PPhPPh PPhPPh;PPhřPPhϙKPPhٙPPhPPh;PPhPPhPPh ;PPhPPh{PPh)[PPh3;PPh=PPhGPPhQPPh[PPhePPho{PPhyPPh;PPhPPhPPhPPh PPhk PPhPPhɚ[PPhӚPPhݚPPhPPh PPhPPhPPhPPhPPh#;PPh-PPh7 PPhAPPhKPPhUPPh_{PPhi[PPhsPPh}PPhPPhPPh;PPhPPh{PPh PPhÛ;PPh͛PPhכ{ PPhPPh; PPhk PPhK PPh [PPh;PPh+PPh'PPh1[ PPh;; PPhE PPhOPPhY5TV_P P}PrqPPhcPPhmk PPhwPPhPPhPPh PPhKPPh+PPh PPh PPhǜ PPhќ+ PPhۜ PPh;PPhPPhPPh PPh  PPhPPh! PPh+ PPh55TV_jP PPh?+ PPhIPPhSPPh] PPhg{PPhq[PPh{k PPhK PPhPPh PPh PPhKPPh PPh PPh˝PPh՝K PPhߝ+ PPhPPh PPh PPh+PPh PPhk PPh%PPh/+ PPh9 PPhCkPPhMPPhW{PPhaPPhkkPPhuPPhPPhPPh5TV/_P P  PPh+PPh^PPh>PPhPPhŞ5TVo_bPPhϞPPhٞPPhPPhPPh{PPh{PPh ;PPhPPhPPh)PPh3PPh=PPhG{PPhQ[PPh[;PPhePPhoPPhyPPhPPhPPh{PPh[PPh;PPhPPhPPhɟPPhӟPPhݟPPh5TV_P PPh;PPhPPhPPhPPhPPh#5TV_jPFj.PPh-5TV_jPj P PPh7+PPhA PPhKPPhUPPh_PPhiPPhskPPh}KPPhKPPh+PPhPPhPPhPPhPPhànPPh͠5TV_PPPhנPPh5TV?_PPPh5TV_5TVa0pЃPhp3Be[^_]ÐUUTff=u EPf E]ÐUS] H= $\!$+$+* "$+$+$+$+$+*$+$+*$+*,#$+$+L#l##$+$+**$+$+$+#$+$+**#$+$+<$$+\$$+$+ %$+$+,%$+$+*$+$+**$+$+L%$+$+**$+$+**$+$+%,&**L&**$+$+$+**$+$+$+*$+$+l&$+$+*$+$+$+$+&&*$+*$+$+&$+$+**$+$+&$+$+*$+$+**$+$+*$+$+*$+$+*$+* ','$+$+L''***' (|(*$+$+$+*$+$+*$+$+**((($+$+($+$++$+)<)$+\)|)$+$+*$+$+*$+$+*$+$+*$+$+*$+$+)$+$+*$+)$+$+))***l****$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+$+**SC SCRS C RSCRSCRSCRSCRxS C R\S$C$R@S(C( R!S,C,SCSCSCSCwSCWSCRDS C R(SCR SCSCSCRS C RSCR|SCR`SCRDSCSCSCSCRS C RSCRSCRpSCGSCR4S C RSCSCSCSCSCwSCWSC7SCSCSCSCRS C RSCSCgSCRTS C R8SCSCRS C RSCRSCSCSCgSCGSC'SCSCSCSCSCSCgSCGSC'SCSCRS C RSCSCSCzSCZSC:SCR$S C RfK]]ÐUS]ScS]]ÐU]ÐU]ÐUfUfH $++++,4,T,t,h `h_]Ðh `h _]Ðh `h_]Ðh `h'u_]Ðh `h4U_]Ðh `hA5_]Ðh `hN_]ÐPh[h `_]ÐUSf]h `j _fuj_]]ÐUE$--4-T-t--h `hlU_]Ðh `hy5_]Ðh `h_]Ðh `h_]ÐPhh `_]ÐUVS] fuh `h_fH$.D.T....d.t...Sh_PhNPh>h `S_6Sh `91&Ph `'Pháh `_e[^]ÐUWVS]fufuf} =t SPEU$/4/D//040hҡ=uӡ١=xtHjXPZPXP5V5VRjQ5V(P%P%P5V=th `h>=t_h `h#=t?h `h1L_+PhA%P%P5VWfujG_e[^_]ÐUWVSfufE f}=t)URSPURPSe[^_]ÐUUMQ%P%P Q]ÐUVSfE fu=t.URS-h `URC_URPrSLe[^]ÐUPVSuU E=xtVPR]S_jXSZPXP Q QhPjhW Q.PRZPXP Qe[^]ÐUSMU E=xt:jXPRQSSh^jheS+PRQS]]]ÐUS] UhlS_u Shn]]ÐUR_]ÐUUR]UURU RUR]ÐUEP]UUUE U$EU]ÐUU RhUR;_]ÐUuu hUR_]ÐUVSuE H$333H444h5(5hV_EPV!hV_Et~6t!/URhV_URhVOURhV?Et~6t!/URhVURhVURhV}uuuhuuhV_SURtVj"_t; uVPC~_;uVj"n_gSUR$tG; uVPC6_;u'EPVE U Rhh `_[^]ÐUWVSuU 0ЃRpSO_EPhS_Ltlu  EEMNMNMN d[^_]UWVSuU 0ЃRpS_EPhSS_Ltlu EEMNMNMN d[^_]UWS]0ҋ} ҃} j jE P_ELtlu UEECECEC ؍e[_]UWVS]U 0ЃPBRfEEususus ؍e[^_]UWVS]U E0ЃxА8et8EuEH9}jR_]EMKMKMK ؍e[^_]UWVS]U E0ЃxА8et8EuEH9}jR_]EMKMKMK ؍e[^_]UWVS]U 0ЃPR{EEususus ؍e[^_]UWVS]U 0ЃPRfEEususus ؍e[^_]U1]ÐUURj _]ÐUVSu=t.19~VR_C9VU R_e[^]ÐU]ÐUE]ÐU]ÐU1=tH]ÐU]ÐUDWVS&XU R Php_ }~] suj_htfh8@jb_htU R]St=tt =t9ETj_U =tt  `=0Ѓ޿u;PSW_ =|uhhW_0Rhhh `_j_h;R;_ƃu*< `SRhh=h `(_ji_Sv==xuS 9 hkh `_1=~}PQhh `_=tu V_B=PRV跸=tu V_=xt|1[^_]ÐUE@@ @@@@]ÐUWVS}u ]hVWL_ <7w$=h?===>=============================?(?>=>8?=======>=H?=====X?D `SD `R_D `SCD `RjwCCteD `SRAH `e[^_]ÐUhh `_hhh `_ h£h `_]ÐUhģh `_hңh `_hh `_hh `q_ h@h `__]ÐUj_U=t R_]UWVS]0PSV_e[^_]ÐUUBu 1]Ð: t: uЉ]UU 8 t8 t]ÐUWU:t0D}]ÐUWS]0Ѓxڐ: t: uJHy|tDe[_]ÐUWS]0ЃU ) CJe[_]ÐUE€8t:/uBB:u]ÐUWU0Ѓ9v8.u H9w}]ÐUS];tN9t `t#9t `C;u]]ÐUS];tN9t  `t#9t `C;u]]ÐUEuhh `W__Pj_]ÐUWVSu] 0P._uPS6V_e[^_]ÐUSUR_Ãu؋]]ÐUh_j_UWS]0Ѓx</ttڐJHx:/tuu ;/tt}1SPPhدhi_e[_]ÐUWU0Ѓx </tHyDPhޯh_}]ÐUhS_hI_jjjjjh5_]ÐUhC#_jjjjjhg_]ÐUSEU M]]]ÐU4WVSU} 0Љƃ~ttRhRhP_ =u#Phh `ʾ_ hS螾_ktC;uE PShP_19u ~+PhS&_ tF9u 9u 0ЉƃVRSi_ t(: u CECB:uh `Sٽ_01t CF0щȃ9r1UJ9} .CF9|h `Ps_hðh `I_P蚼_[^_]ÐUh `購_h԰h ` _MQM QMQUE8tRPh `_hְh `Ҽ_jP]ÐUh `C_hٰh `蜼_URU RUR3EPURh `I_$h `h۰w_9}j]ÐUh `û_h߰h `_U E 8tRPh `_hh `_jq]ÐUh `c_hh `輻_hh `譻_U E8tRPh `c_h h `脻_j]ÐUh `_hh `L_E PURh ` _h `h;_ 9}j]ÐU SE],tPhEP_ EPU(RU$RU RURURU REPURhUR袺_,9}j ]]ÐUS],h5h `]_S蟹_U@EPUR}_fEf ]ÐUhUR/]ÐUhUR]ÐUjUR_]ÐUhUR菷_]ÐUURU RURԿ_]ÐUURU RUR_]ÐUUR_]UURL_]UEP!_UU)Ѝ<]ÐU]ÐUS]M 1ҡ tB됐]]ÐUEE ]ÐU< `]ÐUUR_]UUR贷_U]ÐUU1vvfvfvfvf@]ÐUfUf~ ff~ff~ff~ff~]ÐUWVSEH#4>w< t$ 8< +9s2v QPh(rǁ(=5]VfEEEʚ;t%C9r9Ev ]EUڋu݃}t7M9M9U)v EPREfE:Ћt" S)vsPRff@f~ȁ'w`+9s2v=WP_h(2( 5);:Vr5e[^_]ÐUVSu EH#>ww 4 S ^4e[^]ÐU09~4|9~]ÐUVS]9sDPXP‰։uKȉ1BE)ЉEEe[^]UWVSu] }Wtr+tttH)‰Pnuhh `_e[^_]ÐUWVSuVE} P%EuMEu hٳh `蹳_>;9Ju6VE} P} 77u}7e[^_]ÐUVS]u URlSPe[^]ÐUWVSuf] Ãǃ9=8=4tIJ#U+ 8)щ9r MQR$4 HP}P8P 44 Mf FBfKf)=8=Ee[^_]ÐUVSEM fpFAfJfe[^]ÐUVSEu fXFC8t1fIfe[^]ÐUWVS} ff=(SWKURS}_4f@VSWURSN_SV[^_]ÐUWVS=4EtlW_G)E9_vLUփSh<J_Sh `+h `j ð_tu%9_w?uURhA_e[^_]ÐU48]ÐUWVSf} ft>UffT R)fÍIf÷f]fEEfEft5f9{uURRufCfuf9ujhh PUROf{EfEfSffEe[^_]ÐUE U9s]ÐPR]ÐUUЉ]ÐU]ÐUVSuSE PqVS躮_[^]ÐUVSf95|4Sh_Sh `h `j __fFf95}͍e[^]UVS1Sh袳_1f]ft fBf\fuPhk_fEft,h `j ܭ_Sh `f\fuh `j 谭_fFf`Ph_e[^]ÐU1ҐfEfBf~fjhf]ÐUVSuf] Éڃ)EjEPFPzffMffNV e[^]ÐUEPBUjURPh]ÐUWVSE uf^fCVH9 :fKufFfV f9P }fP fV fV f9P ~fP fV e[^_]ÐUVSE uf^fCVH!fKufFe[^]ÐUWVSE uf^fCVH9!:fKufFfV f9P ~fP fV fV f9P }fP fV e[^_]ÐUWVSE uf^fCVH91:fKufFfV f9P }fP fV fV f9P ~fP fV e[^_]ÐUVS]sfCfHfuf!‰f{tfCfHf f)fKfC f fK e[^]ÐUWVS]fu fES} fCf{ f{ f9~fs f{ f{ f9}fs e[^_]ÐUWVS]fu fESЋ}!fCf9s u f93~fC f9s u f~fK e[^_]ÐUWVSuf~u@f~ 1fV f9-NMfуMMM}fCfBf9~f^Fe[^_]ÐUWVS]fs fS f91{fу}fS fBf9~1e[^_]ÐUWVS]fs fS f9|1{fу}fS fJf9}1e[^_]ÐUVS]S2VSXe[^]ÐUSEU fXfCHR#ufKu1]]ÐUVSEU fpfFXJ9ufNu1e[^]ÐUUfB f9B |$fJfARt 1]ÐfIu]ÐUWVSuf~ f^ f9AfЋFك}PU ҃u1fCf9~e[^_]ÐUWVSuf~ f^ f9AfЋFك}PU ҃tfCf9~1e[^_]ÐUWVS}fW fU1f_ f95fЋGك}PU ҃tfFfCf9]}f%e[^_]ÐUWVSE uf^fCNP:9fKufxf~fx f~ f@ fF e[^_]ÐUVS]fu S.PS4fCfs fs e[^]ÐUSMfQfBAfJufAffY fA ]]ÐUWVSuf~ f^ f9/fЋFك} PU ҃fCf9~Ӎe[^_]ÐUWVS}u 1ېWޤ_{uVHWƤ_}t&EPhW7_URV-CӐf^e[^_]ÐUEPhRǤ_]ÐUVS]u hS褤_h_VhS莤_e[^]ÐU]ÐUEM f9s]Ðf9v ]Ðf9rw1]Ð]ÐUU %P%PhLMQ_]ÐUSu1=t@<uÅtKu]]ÐUS=tЃ;uh`肠_]]ÐU=XuX]ÐS\$̀}أh[Ð[ÐSV\$̀}أh[Ð[ÐS\$L$ T$̀}أh[Ð[ÐS[\$L$ ̀}أh[Ð[/lib/ld.so: can't load dynamic linker '/lib/ld.so' statically linked 8UWVSl$L\$P=D$D bhbt[|$)b ft8t@8u+PSj j*D$Pj hZ񐐐hhT$\RSD$ PPD$\ЋT$,RT$,R &|$Sb+jD$PjM j[^_]8ÃfT$fur|$fD$f%fD$f%?fT$f fD$l$ÐUWVSl$|$198v <WUT$RЃ C98w[^_]Ðlibc.so.4DLL Jump 4.5pl26TLLLLLLLL! LL#LLLLLLLLLLLLLLLLLL"P$ViJSZNWKUOWWWWWWWWXQ^]_bVxURvyRiY\WLVxURvyT[LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL! LL#LLLLLLLLLLLLLLLLLL"P$ViJSZNWKUOWWWWWWWWXQ^]_bVxURvyRiY\WLVxURvyT[LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL! LL#LLLLLLLLLLLLLLLLLL"P$ViJSZNWKUOWWWWWWWWXQ^]_bVxURvyRiY\WLVxURvyT[LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL! LL#LLLLLLLLLLLLLLLLLL"P$ViJSZNWKUOWWWWWWWWXQ^]_bVxURvyRiY\WLVxURvyT[LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL]L` Xaef01IYZ12[}bG23IYZZ~[}bGc__WWWWWWWW Yba3445`[56fz__6778Z~899::;;<<==>>?_a?@Z@AABBCCDDEEFFGGHHIWIJJKUlzXm]eabcij_ ^g^dOk_f_h}b~' zKeK]O`]d]d]d]d]d]d]d]d]d]dKa }b~' z          }]d~                           K]                                                                                                                                                                                                                            !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""################################################################$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%%$^^^^^^^^^^^^^^^^^^^^^%%%%%%%%%%%^^%%%%%%%%%%%%%%%%%%%%%%%%%%^%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((())))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))****************************************************************++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,----------------------------------------------------------------................................................................////////////////////////////////////////////////////////////////0000000000000000000000000000000000000000000000000000000000000000111111111111111111111111111111111111111111111111111111111111111122222222222222222222222222222222222222222222222222222222222222223333333333333333333333333333333333333333333333333333333333333333444444444444444444444444444444444444444444444444444444444444444455555555555555555555555555555555555555555555555555555555555555556666666666666666666666666666666666666666666666666666666666666666777777777777777777777777777777777777777777777777777777777777777788888888888888888888888888888888888888888888888888888888888888889999999999999999999999999999999999999999999999999999999999999999::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<================================================================>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>????????????????????????????????????????????????????????????????@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEF|F|EddddddddddddddddddddF|FFFFFFFFFFddFFFFFFFFFFFFFFFFFFFFFFFFFFdFFFFFFFFFFFFFFFFFFFFFFFFFFFFHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIJ`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J\J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`JJ`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`J`MMMMMMMMMMMMMMMMMMMlMMMHMMMMMMMMMMMMMMMMMMMMMMMMlMMMHMMMMMMMMMMMMMMMNNNNNNNNNNNNNNNNNNNNNNCNNNNNNNNNNNNNNNNNNNNNNNNNNNCNNNNNNNNNNNNNNNOOOOOOOOOOOOOOOOOOOOOO"OOOOOOOOOOOOOOOOOOOOOOOOOOO"OOOOOOOOOOOOOOOPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQQQQQQQQQQQQQQQQQOQQQQQQQQQQQQQQQQQQQQQQQQQQQOQQQQQQQQQQQQQQQQQQRRRRRRRRRRRRRRRRRRRRRRRRRsRRRRRRRRRRRRRRRRRRRRRRRRRRRsRRRRRRRRRRRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSASSSSSSSSSSSSSSSSSSSSSSSSSSSASSSSSSSSTTTTTTTTTTTTTTTTTTTTTTTTTTTTT3TTTTTTTTTTTTTTTTTTTTTTTTTTT3TTTTTTTTUUUUUUUUUUUUUUUU;UUUUUUUUUUUUU:UUUUUUUUUUUUUU;UUUUUUUUUUUUU:UUUUUUUUVVVVVVVVVVVVVVVVVVVVVVMVVrVVVVVEVVVVVVVVVVVVVVVVVVVVMVVrVVVVVEVVVVVVVWcVWWWWWWWWWWWWWWWWWWWWiMWziLi/i^ioinWWi.i-i,Wzi+i(i*X`i'i&i)i%i0WXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXiXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX\`\`X\f\`\`\{cc c c c c c c c c c \`\`\`\`\`\`\`cz\`\`\`\`\`\`\`\`\`\ c cz\ceeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeegggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhjjjjjjjjjjjPjjjjjjjjjjjjjjjjjjjjjjjjjjjPjjjjjjjjjjjjjjjjjjjjjjjjjjkkkkkkkkkkkNkkkkkkkkkkkkkkkkkkkkkkkkkkkNkkkkkkkkkkkkkkkkkkkkkkkkkkllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllmmmmmmmmmmmmmmmmmmmmmmmmmmmmmTmmmmmmmmmmmmmmmmmmmmmmmmmmmTmmmmmmmmnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooopppppppppppppp)ppppppppppppppppppppppppppp)pppppppppppppppppppppppqqqqqqqqqqqqqq6qqqqqqqqqqqqqqqqqqqqqqqqqqq6qqqqqqqqqqqqqqqqqqqqqqqrrrrrrrrrrrrrrFrrrrrrrrrrrrrrrrrrrrrrrrrrrFrrrrrrrrrrrrrrrrrrrrrrrssssssssssssskssssssssssssssssssssssssssskssssssssssssssssssssssssttttttttttttttttttttt2ttttttttttttttttttttttttttt2ttttttttttttttttuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuvvvvvvvvvvvvvvvvvvvvvvpvvvvvv%vvvvvvvvvvvvvvvvvvvvvpvvvvvv%vvvvvvvvvwwwwwwwwwwwwwwwwwwwwwwwwhwwwwwwwwwwwwwwwwwwwwwwwwwwwhwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxx5xxxxxxxxxxxxxxxxxxxxxxxxxxx5xxxxxxxxxxxxyyyyyyyyyyyyyyyyyyyyyyyyyuyyyyyyyyyyyyyyyyyyyyyyyyyyyuyyyyyyyyyyyz]z]yzdzdzdzdzdzdzdzdzdzd{`{{{{{{{{{{{{{{{{{{{{||||||zd{{zY{|[Y|[|mmtt77??==BB88**  oo!!##$$&&gg((++,,--//qqSSDDww11  jj  nn  QQ    ..004499<<>>@@                                                                                                                                                                                                                                                                                                                                      pptx|PL(h(h(pppph(h(hp0p0p0p0p0p0p0p0p8pxX8~8x8x8xt\,0 ` ` ` ` `؂$d$d$d   $ d$d$d$d$!d"#$$&d'()$+d,-.$0d123$5d678$:d;<=$?d@AB$DdEFG$IdJKL$NdOPQ$SdTUV$XdYZ[$]d^_`$bdcde$gdhij$ldmno$qdrst$vdwxy${d|}~$d$d$d$d$d$d$d$d$d$d$d$d$d@~pppppppppppppppppp<L$48@DT\T  0Dhl xpppp ppppplpp@ppppPppppppppp(ppppppL__LLLLLLLLL LLLLLLLLLLLLLLLL`e$! p(  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~"%s" '_' out of place"%s" '_' out of place"%s" '.' out of place"%s" '_' missing"%s" '.' expected"%s" Too large for character set'%''Syntax error: Bad characters between %%%%Syntax error: Newline in constantUnknown token "%s": Scanner: internal error : Scanner: out of memory : Scanner: too many nested include files : Scanner: file stack underflow (too many calls of CloseFile) : Scanner: cannot open input file class class Warning! VCRN. Name in final comment does not match class name. |sj_\UE<5.' }xnic`TMJA60)%" }|FREE_OPERATORRESULTCURRENTNOT_EQUALSINT_REMINT_DIVNOTGT_GTLT_LTSTRIPOLDBITLIKEALIASEXTERNALONCEPREFIXINFIXGT_EQLT_EQIMPLIESOR_ELSEAND_THENXORORANDUNIQUELOCALREV_ASSIGNCREATIONIFELSEIFA_BITSTRINGCHFALSETRUEELLIPISESWHENINSPECTFROMLOOPUNTILVARIANTEIFDEBUGCHECKRETRYRESCUEEXPORTALLSELECTREDEFINEUNDEFINEASINHERITRENAMEINVARIANTTHENENSUREREQUIREELSERIGHT_ARROWINDEXINGA_REALAN_INTASSIGNOBSOLETEMANIFEST_STRINGFROZENISIDENTIFIEREXPANDEDDEFERREDFEATUREENDDOCLASS}{^][>=<;:/.-,+*)($!_EndOfFile c_` M P(R!`*a+7g-/_5 NOPQ45x7426+./49? A ##%&B$$? #GH DZ$@  b,  0""#D11.    (1@A$4 !""#1<1&& ,- B%%(((=(' 96&"<=<<1%8: ==9I7 &FF;% >     :;I  F  7k  =>?>kkkk'''',UU    0k a''(9'''89',,,7 ,93000>018"KK':k3CCH27 7 7 EE9HHK>HLMHUUC:::9E;>H3L%mkkkkkkkkkCDkkQQE9TUkk;Dkkkk8"8"m3HH;33kkkkJ3k8"K8"8"8"3;233kkkk;;;L%L%8"L%L%L%SS3SS;;;;L%YTTYTSTVVVVWVYZf~QTWQQ WXVXW;;X!<WL%L%XmSS-YQ Q Q Q JTTYYK-VVWW"X-mmWWXXf~f~f~f~f~h~f~m)hgh~h~h~h~h~h~h~f~mf~f~f~f~h~h~h~mf~f~mmrrrf~f~f~f~f~f~99*+h~9r99rri9iiir1jlnph~rrh~h~rtvh~h~h~h~h~h~h~h~h~h~h~h~h~h~x[h~h~h~h~h~h~h~h~h~h~h~h~h~h~h~iiikiiikkkkkkkiiiiiiiiikkkkiiz|~i ii9jlnp399    rtv2[kk\k]kvkkkkkkkxkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkmvvvmmmmmqqq#$%mmmmvvvz|~qqqv&'()vvqqq^_b[dewmmmmmmmwmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmommm9ooooowwwwwwwoooo3wwwwwwwwwwwwwwLwwLoooo^oooooooooooooooooooooooooooooooooooooooqoooqqqqqqqLLLqqqqLL^L^^LLLLLLLLLLL^^^^^^MMLLqqqqq^^qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqsMssMsMMMMssssMMMMMMMMMMMMMCCsssssssssssssssssssssssssssssssssssssssssssusss@uuCuCCC@uuuu@CCCCjlnpCCrtvuuuuuuuuuuuPxPuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuwuuuwwwwwwwz|~PPPPPPPPPPPPPPP~PPgww~wwwwwwwwwPPwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwywwwyyyyyyy~~~yyyy~~~~~~~~~~~~~~y{{{{~~yyyy{yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy{{{{{{{{{{{{{{{{{{{{{}{{{{{{}}{}{{{{{{{{}{{{{{{{}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}jlnprtvxz|~zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzg~~~~~~~~~~~~~~~~~ujl~np~~~~~~urtv~~~~~~~~~~~~~~~~~~~~~xuuuuuuuuuuuuuuuz|~uuuuuuuuF G "CYi?D ED @D A B C ILJKLST7GP$%'X]0f%'U%'XVQWX<M44MX>X6^X@Xa:XOHR7Z,B.XEXhIJSnTYo\Np[,f._8q`8c8d8b:XXFXe8Lg8jfKLkfKL N Ll N  a ffVM N tP N fMPLuvxyfRmfsMwtuhvxyXtfutvxyfu}vxythuivxytfu|vxyt{futvxyfuivxytfukvxytfumvxytofutvxyfuqvxytfusvxytfuuvxytwfutvxyfuyvxytfu{vxytfu}vxytfutvxyfuvxytfuvxytfuvxytfutvxyfuvxytfuvxythuvxytutvxyurvxytuivxytfuzvxytuvxyt~uuvxytuvxytuvxytfuvxytuvxyutfuvxytfuvxyuhtuhvxythuvxyiuhtuivxytuivxytuuivxytuvxyufutuuvxytuvxyutuvxytuuvxytuvxyuLxl@ 4T0\p\(hdhH<Hd "#%@(*p-02L579,;\<=>,@xBEGTJMOHR TW#  Z&)['!< ,t!$! ,,.,pp,`$&D14 H d&36!4D , CTDP ( _~]>_~]B_~]D_~]~]F_~]~]H_QQQQQQUU+;9999H9CGKQUVQQhQQUQ  0           $$%%!!"&&####(((''))***++   -....////////////////////,,,,,,,[[[+))[],!!]]]];;},}};;;:):))())!)!!!!!!!!!!!!!!!!!!!!!!.))!!)*;((!!!!!)),,!!.(3l2$&'}\Z][UVWXY,/idghfeyj865!#  0)|{ostponNO`?FHIG<SQ=:TRAEbc*+.pOnly one class per file is allowedLocal variable cannot be initialisedLocal variable cannot be initialisedCan't assign to "write-only" entityCan't assign to "write-only" entityPOINTERSTRINGINTEGERREALDOUBLEBOOLEANCHARACTERNONEVIRW: Identifier "%s" is one of the language's reserved words %d:0                               ܋ʋvj^Q=)׊͊~obQI?6/'ىljuaMA4'݈ˈraP@3/!݇̇{riWG6%؆͆yi_P@0&ׅ˅|wqkeZNB8-" ڄʄwng_WMB7&׃˃sfYRMB6)݂ӂɂxmbUH:0&܁с~xtod[UMD<71*# Comment1Comment0CommentIdResultCurrentEntity0EntityString0StringBitseq_NONE_BIT_STRING_BOOLEAN_DOUBLE_REAL_INTEGER_CHARACTERRealIntFalseTrueChManifest_constant0Manifest_constantList2List1List0ListImplies_binaryXor_binaryOrElse_binaryOr_binaryAndThen_binaryAnd_binaryGteq_binaryLteq_binaryGt_binaryLt_binaryNequal_binaryEqual_binaryPower_binarySub_binaryAdd_binaryDiv_binaryMul_binaryIntDiv_binaryIntRem_binaryFree_operatorBin_opNot_unarySub_unaryAdd_unaryUnary_opStripOldManifest_arrayParenthUn_exprBin_exprCallSimple_exprComment_exprExpression0ExpressionAddrActualActual_list1Actual_list0Actual_listActuals1Actuals0ActualsUnqual_call1Unqual_call0Unqual_callCall_chain1Call_chain0Call_chainType_list1Type_list0Type_listAssertion_clause1Assertion_clause0Assertion_clauseAssertion1Assertion0AssertionEnsure2Ensure1EnsureRequire2Require1RequireCondition1Condition0ConditionActual_generics1Actual_generics0Actual_genericsAnchoredSimple_typeBit_typeClass_type_expandedClass_typeType0TypeLoop_body1Loop_body0Loop_bodyDebug_keys1Debug_keys0Debug_keysRetryDebugCheckLoopMulti_branchConditionalRev_assignAssignCall_instructCreationInstruction0InstructionConst_attrValIntervalChoiceChoices1Choices0ChoicesWhen_part1When_part0When_partWhen_part_list1When_part_list0When_part_listThen_partThen_part_list1Then_part_list0Then_part_listCompound1Compound0CompoundConstraint1Constraint0ConstraintFormal_genericFormal_generic_list1Formal_generic_list0Formal_generic_listFormal_generics1Formal_generics0Formal_genericsEntity_decl_groupDeferredExternalOnce_bodyDo_bodyInternalEffectiveRoutine_body0Routine_bodyFormal_arg_list1Formal_arg_list0Formal_arg_listFormal_args1Formal_args0Formal_argsFeature_list1Feature_list0AllFeature_listNew_export_itemNew_export_list1New_export_list0New_export_listOp_nameInfixPrefixOpIdent_nameFrozenFeature_nameNew_feature_list1New_feature_list0New_feature_listCreation_clauseCreators1Creators0CreatorsRename_pairRename_list1Rename_list0Rename_listFeature_adaptation1Feature_adaptation0Feature_adaptationParentParent_list1Parent_list0Parent_listLocal_decls_list1Local_decls_list0Local_decls_listRescue1Rescue0RescueLocal_decls1Local_decls0Local_declsRoutineUniqueConstantAttributeFeatureDeclaration_bodyFeature_declFeature_decls1Feature_decls0Feature_declsClients2Clients1Clients0ClientsFeature_clauseFeatures1Features0FeaturesDeferred_classExpanded_classClassClass_header0Class_headerSimple_index_clauseTagged_index_clauseIndex_clauseIndex_list1Index_list0Index_listIndexing1Indexing0IndexingClass_comment1Class_comment0Class_commentClass_declarationClasses1Classes0ClassesEiffelNoTree  ! !"#(%&'(+*+.-.1014345878;:;<?>?@CBCIEFIHIJMLMNRPQRUTUXWX`Z_^]^_`adcdgfghkjknmnqpqrutuxwx{z{}~ X%s %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%s%*cTree: error in GetTree %hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*cFatal Restriction Error Warning Repair Note Information Error class: %d syntax errorexpected tokensrestart pointtoken inserted error code: %d: %d%d%cinfo class: %dVALIDVWCA: Constant attribute errorSYNTAXSYNTAXSyntax errorexpected tokensrestart pointtoken inserted Error code: %dSYNTAXSYNTAXSYNTAXSYNTAXwCan't open "%s" for case mode output%ld%f''0x%x0%o%d0x%xl0%oL%dL%e%f[printConst: unknown type (%d)]%x%o -help.e.atr.atr%s: bad source file name: "%s" w%s: cannot open output file: "%s" (errno=%d) Too many errors. s%d error%s. e:vbp:C:c:n: Usage: %s [] options are: -b binary output mode -e stop after errors -p output is written to -v verbose wr^YXSRMLGFA@;%  | z®  zu_3ZM4H853$ έ ɭȭíE|w] XWR= 87 X2!O"Q #$7۬%L֬&U'e|(^wb)f]L*G/+*,- ./۫0 1nu2np[3sVD4q?25&-6$789:Ū;<=>p{_?pZE@o@2Av-BwCEԩEϩFG{HfIaJJE/K*Address Argument ValidityVZAARetry Constraint RuleVXRTRescue Constraint RuleVXRCStrip Expression ValidityVWSTOperator Validity RuleVWOEManifest String RuleVWMSManifest Array RuleVWMAConstant Attribute RuleVWCAVWIDEquality Expression RuleVWEQBoolean Expression RuleVWBECall is ValidVUGVCall is Export-validVUEXCall is Class-/system-validVUCSCall is Argument-validVUARUnconstrained Genericity RuleVTUGVTEGClass Not Found In Specified UniverseVTCTVTCGVTBTVTATRoot Class RuleVSRCName clash in ClusterVSCNRoutine RuleVRRRLocal Entity RuleVRLEFormal Argument RuleVRFADuplicate Feature declarationVREGUnique Declaration RuleVQUIManifest Constant Initialisation RuleVQMCMulti_branch RuleVOMBSelect Subclause RuleVMSSVMRCFeature Name RuleVMFNFeature Name ConstraintVMCNExport List RuleVLELExpanded Client RuleVLECExport: Client exists in UniverseVLCPProcedure Call SyntaxVKCNAssignment Attempt RuleVJRVAssignment RuleVJARVIRWRename Clause RuleVHRCParent RuleVHPRClass ANY RequiredVHAYVGCSCreation Clause RuleVGCPVGCICreation Instruction RuleVGCCFeature Declaration RuleVFFDEntity RuleVEENUndefine Subclause RuleVDUSVDUCRedeclaration RuleVDRDRedefine Subclause RuleVDRSVDOCJoin RuleVDJRVDDCVDCNEnding CommentVCRNFormal GenericsVCFGClass HeaderVCCHGeneral Validity RuleVBGVAssignment ConformationVBARLoop Variant is an Integer_expressionVAVEFeatures Available in PreconditionVAPEValid `old' expressionVAOLConformance in ExpressionVNCXSignature ConformanceVNCSVNCNVNCHVNCGVNCFVNCEGeneral ConformanceVNCCDirect Conformance (Bit_type)VNCBSyntax ErrorVUNDFreeing at zero!!! Memory allocation error%*.*s%sEON/Eiffel. (c) Eon Software 1993 All rights reserved Version %d.%d.%d.%d (patch level %d) EON/Eiffel. (c) Eon Software 1993. Version %d.%d.%d.%d (patch level %d) }.e%s.e%sIn file: %s r%s(%d): ^ At end of file. . . . Compiler Error! Contact EON Support. . . -%d%s%s %s %s %s %d %d %s %c *** Terminated *** $Id: System.c,v 1.8 1992/09/24 14:20:40 grosch rel $rrb$Id: General.c,v 1.5 1992/05/05 13:19:05 grosch rel $$Id: Memory.c,v 1.13 1992/06/24 12:23:15 grosch rel $$Id: DynArray.c,v 1.6 1992/08/17 11:42:24 grosch rel $MakeArray: out of memory ExtendArray: out of memory $Id: StringMem.c,v 1.11 1992/05/05 13:19:05 grosch rel $%8x %5ld Bytes $Id: Idents.c,v 1.12 1992/05/05 13:19:05 grosch rel $%5d %5d%5d Idents = %5d $Id: Sets.c,v 1.10 1992/05/05 13:19:05 grosch rel $%d %d{}Sets: sizeof (BITSET) = %d $Id: Positions.c,v 1.2 1992/08/13 13:47:33 grosch rel $%4d,%3d\d d``op?`peon3122/bin/eon000755 000000 000001 00001106600 05710543454 013556 0ustar00rootother000000 000000 d@ 蛤-̀\ `D$4 `*P茥ĥP`[̀UWVS]΢U RPh ` ~M qбu:j+`h]j `h`u hֱht6hU RSE7ƃuxxu{:j`F9}hh9u#xxUtxTuhh M Qh_$dtۃ=̱t؍e[^_]ÐU]ÐUVS]1x輇+vNQxxxt,PdS0qR4jvh.hhh`h` G9=B19=DžDžxx~ Qh&`0x t%uVRh%_h `_ QWn1PrƃuRh2NDQWR^S2uBSQ`Rj6Vf\ SR_xx Q0Rj QrPRPPhY Q` Rj Q*_ tAxx~Rhe_ QR Qi G9=xx<xtk=tUh~7_19=~K8q1ېDP8qRh_ G9=h_19=~C4 Q8qR`u x@$vG9==O8qƐxxt!Rh@_4x tS Qhδ_h `*_ 9=%PR Q_ Q Q_;u8\xxt Qh@_xzu-ız t P QKÃ1ۡxx~ShDD_t1xx uxt h\"_A;[M QrUÃ}xxtM Qhu_؍[^_]ÐUWVS1xxtM Qhh_!x thh_h `_ xx~M Qhh\_ M QSi_SjSYSSh8_ u#xxux~ hǺ_M QSjESKxx~&@PhPm_ ƅM QMQ QuPtPxx0tRtPtPuP=P1t FO)ȺtPR =P1t FO)Ⱥt R=01t FO)Ⱥt0R=01t FO)ȺtRxBPuP"zPtPPh#h' Q_L=t0hV Q_ Q Q_;uhXxxt QhX_xzu-ız t P Q{Ã1ۡxx~Sh\t_M QSy_Sx x0uh 0QSPMQht Q_ Q$_ PQSPMQh~ Q_4 Q_ 8QSQPMQh Qa_ Q_x x uxt h_}uV1[^_]ÐUWVSuDždDž`0pDžt PhDžlDžxDž|U:RPM QhRx_0=ЋDj Q_tLxx~Rhx_h QT_uRh˻ChM Qh@_ u(xxux~ h_DždhjU RTǡx x~,WpQU RxQh _h `_U:thEPjl@ EpQWPURh2 Q _jR_ t*xx9 Qh<&_#8RWMQPURhU Q_jRF_$ QËpRWPM QhaRH_ Q 9hRWPM QhkR_j Q_ u3R'9~PxxWhuxxWh_xx~ h_xxu-pQWxRh_2x txQht_h `_ UXpVWPM QhV_8RWMQPURh˼S_5`d4=ttMjF9`x hQh׼WR9 QhWx9hRhWxxt Qhl_x{u!ı{ t PRÃ1ۡxx~Sh$_`txx0u`Q_xx0uv0RWPM QhRo_ Q_PRWPM QhR7_4 Q_8RWMQPURh) Q_RI_x x t-h3!_!dt'MQURM Q&t 1T[^_]ÐUWVSjURiOǡxxt 0QWhL_ x tho_h `_0RW QPU Rhw Q_jR_$t Qh&_RË 8QWRMQPU Rh Q_$jR._u3 Q 9} xxqWh_aR QhR_M9thEPj&: E0RWh QPU RhV_ 8QWhRMQPU Rh S_M X5`d$=ttDj 5xhRhS Q5Rh$SE5 hQh0oSxxtRh;<_x{u!ı{ t P QÃ1ۡxx~ShD_xx0uB0RW QPU Rh\ Q[_R_ 8QWUR QPU Rhh Q_ Rf_xx u xhv4_ 1t[^_]ÐUWVSDžDž Q Qj7 Q=xxt Qh_8t-PhQ QP_ QP_ XQ Qh Q_j Q_ Q 8Qj QJPQPPh Q_ Q 9} Dž 8Qj QAJP QQPPh Q_ QJ 9} Dž=?tc HQ Q @QPQhξ Q_j QL_$u! Q9} Dž;uu)xxhھ_ 8Qjh IPh QQhS_0ЃPdt =ttNjg0x pQhN Q0 Qh N0 pQhNxxt Qh(_xzu!ız t P Q?Ã1ۡxx~Sh2D_txx0uQ1_tN XQ QhJ Q_ Q_xx u xhO`8 XQ Qhh QO_j Q_u QrDžPJ9 `QhmJMxxt `Qh_xzu,ız t P Qà 1ۅt*xx t h_1[^_]ÐUS]hjR@CCCC C$C(CCC CC0CPC4CTCUC@CDCHC8C< ]]U=t]Ðh_1]UWVS}u ]h̿VW_ <;w$8t;T8T8T89:T8d:T8T8T8T8T8::T8T8;T8;T8T8T8T8T84;T8d;T8T8T8T8T8T8t999T89T8T8T8D:T8T84:T89T8T::t:T8T899T8D;T8T;C@CD `SPD `D `SHCD `Srj jD `R_CC NC C-CC8C0C C$D `PPPhoS_jS_ uS9Bd~Džxx$$?D?T?d?t???hyNh>h.hhhb_xx~qIHQPh:_PRPh _MQURPIdQ;Ph3_[^_]ÐUWVS}19~91WR_u C91e[^_]ÐUWVSURh8+x_h8+0}Ѓ ~+UtIuRhLh `_ h8+A3Ãt8j jSR_U  {tm[Sh8+_]=`t#`h8+R_t,;u}t.URhv|_l8+YhR_=t%Rh)_>uURhh1e[^_]ÐUWVS}1WKWU=t68u 5dWR_uF;uϸe[^_]ÐU,WVS}Mp> $BtDDETEEEFTFFOFGTGOGG$HOHHITIOIIJTJJJKdKKOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOKKL4LLdMMMNNOOu K 0} хuQ_E؃U RPi_P u  0} хuQ_E؃[u  0} хuQV_E؃u k 0} хuQ_E؃u  + 0} хuQ_E؃ {u ( 0} хuQ_E؃(;u 0 0} хuQV_E؃0u 8k 0} хuQ_E؃8u + 0} хuQ_E؃{u H0} хuQ_E؃H;u @0} хuQV_E؃@u Pk0} хuQ_E؃Pu `+0} хuQ_E؃`{u 0} ЍHuQ_E؃E PhNu X0} ЍHuQA_E؃XE PhUR<_Vu t;E Pu uttu h0} хuQ薿_E؃h[u p0} хuQV_E؃pu |k0} хuQ_E؃|u +0} хuQ־_E؃{u 0} хuQ薾_E؃;u 0} хuQV_E؃u k0} хuQ_E؃u +0} хuQֽ_E؃~u 0} хuQ薽_E؃>u 0} хuQV_E؃E PUR_pu [E Pu u / &`dXu 0} хuQ6_E؃U RP_S+EPURE PWI=Et#hSU_0щʃӃE+E PU RSq_E+E \URS_0щʃӋE@PS_0щʃӃE>cbhWBl75pEPURE PW(EU+U RE Ph+_U+U Ӂö+>~> ukEPS_0щʃhS_0щʃӋE+E PU RS_E+E \CF>uEPS觿_+LBt7+E=tEEEUԋ22E8}t#hS_0щʃӃEHPUԋR@PREPhSH_jS_E؃$u0щʃӃEEEEԃ8)uux؍e[^_]ÐUWVS] }u4E\Ph&Cu hFӸ;$uC;{t hb軸Cހ;}tCuh~蟸吐7Ue[^_]ÐUWVSh_‰u;hPP,PhPݼ_0ۉ׈щȃr,׈щȃt RPPP虹PhPJ_xxtPh|_hPٲ_u< `PPh> PhPղ_P1PhP"_ :0щD P蛹P0щ| \uzщD \:%uKNtTt! / C:uPĸ=0щȃ9s7:-u'z-u!BP޸J9rˋ:tjRP PB_P_[^_]ÐUWVSxxjST_t5< `Vx@Ph*ô 5xv50ۡxxҿ щMuR_h RxRRhGP_/jS襬_t5< `VShN 0҅uR蚳_ESP_0ҿ щMuRT_h RShkPK_e[^_]ÐUWS]tS芬_uShrOhj谯_0ЃƒJ9v 8u9u 8uB|0qxx~ Rhܳ_e[_]ÐUWVSU0ۉ׈щȃw ׈щȃK9v;.uxx~Sh\_0Ph}W_WSN_Eu8PhW軶_WS_EuY޿u 5޿u ;.t 1e[^_]ÐUWVSExx~|Rh`_xxt&@PhEP_ Exx u!hEP迵_E0qR0qRhȰh*Ãv޿U޿>xxux tSh[_Su9xx uxt h%*_jS$t,(xx uxt h>_1SxLxtHQEPEPhMhQRg_twxxtRhc蔰_xxu*ıRROEExxtURhh<_}s·Y$$e[^_]ÐUWVSxxt|Rh_0qRt0qRh軮h.Ã޿t։޿táxx uxtShg_0D0RShR_R:_PRShR_$R_8RShR虲_R_ShR{_$R̴_8Ph(R褴_ 6$0qR螴t0qRhVhƴÃ޿t։޿táxx uxtSh_0Dxx(u(XRSh.Rs_Rdz_0RSRh3RD_R蘳_SRh;R_(Rp_HR|R@RhBRְ_R*_譴e[^_]ÐUhJh `r_ j讦_U]ÐUWShj#_0ЅuP/_XSPX蚰_e[_]ÐU XXPq_XP_]ÐUWVSDž=UDžDžRPh\Rz_jP%_RËPl9XhhRե_u< `PRhj9 PhVz_ tAjhVp_ u͉0щT 말PB_uQJ_Ãu h藩RhV֤_ tmjhV̮_ u͍ t  u A9 t9 tQS:_0щD hS_vR_nPSmRPiS|_:[^_]ÐUS1ې `9 `wjh ` _ `C;~1ې `9 `wj h `ϟ_  `C;~1ې `9 `wjh `菟_ `C;~ŋ]]ÐUdWVS裩PShSJ_S贠_uShy=0ߍ0RhW_RDžDžDžDž8WR轟ÃtoSWhh¦>_=RhW6_RDžDžDž8WRÃtSWhh>i=``0RRhWs_RDžDžDž8WR<ÃtSWhh AxxtWhC0_>IK&%,xxt h\_[^_]ÐU\WVS讦RPhkS\_SƝ_uSht苤=ލxxtVhZ_ 0Q QhV_QDžDžDž   8VQ軜ǃtmWVhh;IH[^_]ÐU=t h~hj苩hPמ_u< `RRh;]ÐUR_R蹞_]ÐUVSu8Yu>t8\u/@8uF> t>> ulxx~/j h 蛣_RPC _;u琐F> txx~h#U_느xx~Ph%3_RP谝_FQRj 莝_xx~ h(_e[^]ÐU$WVSURh*Rn_/U3Uh4R _ÃuRh6yUU܋RhQS_ uU5T uϋURh]S_ t'jh`UR耦_ tURUR,_S_EPjURhcR蕥_xx@ukRhhơ_h輡_@ `9D `wh< `荘_t@ `@ ` YtytjC_hR˛_Ãu< `RRh2 URSh軛_URhS蜛_Sh衛_ EPhS_Sh脛_hSi_hS^_$hSP_hSE_Sh*J_URURh4S"_(URnShI_Se_URhRo_he_UṚe[^_]ÐU]ÐU]ÐUWVSU uUE]xx~FVhU_Sh_PhП_Sh迟_ U}EPVU诣_EUExx]SEPh Uc_]Sh,R_>UEfx(t;QhBU-_QU]f{&tNQhUU_$dUEfx*taQhhU_U}ux|BM}ur]{1M{EPEh}RU(_U0щ˃ڃ FE8~1M萐B];t EC]E.]F~N}u91EBE8t]@EE.EF~ы]f{*u =t>}uQRU谡_U0щ˃ڃ}uoBEfx&u =tC}uQRUU_U0щ˃ڃ}utBEfx(u =tC}uQRU_U0щ˃ڃ}udB1Efu<}u:B0щ˃:BED,PRUW_U0щ˃ڃxx~]\,ShU_UFE9W]]}y}u9ZffB0ɉ׈щ˃1}u%׾0Ѓƒ=t<}uQRUN_0UЃƒ}uoB=u xxtB}uQRU_0UЃƒ}utB=u xxtB}uQRU蔞_0UЃƒ}udB}u EPxx~]Sh_e[^_]ÐUWS]jSh/L_/ Sh/_/=/t8.ux@8u/.h/}Ph0//P"_/e[_]ÐUWVS=Wg;=W[;1Ƀ9J~)D 9uh_]A9Jڃ=u=W:P<1}9|  xx~ hD躘_9xx~RhU_PajEPBP1ɃB AD 9t9Jˋ9rxx~PhZ_P`jEPBPZF9pe[^_]ÐUWVSUR~Ej_Ɖ}0хuQ_EURPf_} 0хuQ轕_ECU RP2_EH0CUH01e[^_]ÐUWVSEPh_uV~_VÃtj j[SZ_j=_ÃV|0хuQ _xVP肚_j_xCU RhcP_ }t8}0хuQ讔_xCURP _ C|H0C|H01l[^_]ÐUVSURhfuVO_VH0t&RV菙_u [u1x[^]ÐUURtj]ÐUVSuVH0tRV_u [u1e[^]ÐUVSuxx8V+}Vhk蝓V jEPV$0RVPEPhR_(V;jR赋_ u3\ËR'9~xxtVh_Ve[^]ÐUWVSURhuV莗_V|j`_Ã0ЅuP<_VP踗_fU fS| H0K|H01p[^_]ÐUWVS}xx~Wh:_W%4H0f~ 8=PW_VRR_fF xx~419~h貒_C9VRRh蕒_ VRjEPVRVRQURVRxVR  v+e[^_]ÐUH09tf@ @u9~]USU1ɀ:t B:uȻXЋ]]ÐU帤9=H0}]ÐUS]Su Sh蕐]]ÐUWVSjURRlCPR60uJ|RVX(=tRVX;ue[^_]ÐUWVSxz~ h͐_=`t`jjP ;uE=EExx~URh e_}EPuEtURh+h5螖Ã޿8t։޿:tÉ0щMD SGjURSǃ~S蜓<WEPSh=蛎khREPhR_hPÉ_EEEURhPx_E ; tӉ0щMD C;t ; t; u; t; uC;uR S0щʃv8щMt uщMD 5uE5uE}t }}S u7hPURShh `8_"j jIQ7_E SEPRǃ ~PShV S REPSOǃ RSh EP_EEEU:ie[^_]ÐU]ÐU]ÐU]ÐU]ÐU]ÐUh4g]ÐUVSuVh/i_=tTh/裏h/mÃu"} u12VhOCu@Ph/ _/e[^]ÐUjxx%PR%F }Rhh{脊]ÐUHtH]ÐUS]h+xxtSh2_ttSx@P|Rh>Y |Rhhъ_y|RLÃu|RhNxxt|Rh耊_x@PSMt|RhV_]]ÐUPWVSDž0qRRt0qPh7hQvÃ޿Rt։޿TtÍEPS虍_tE@t0хuQ._SPB蒍_`Dž9NRU_hWAt0qPhYhsjÃ޿tt։޿vtÉ0щ΃8щȃ9vRމ0щʃ)Pm_PSV_BϏ0qRK_P谉_9[^_]ÐUVS]SRƃ} 13S:VstP"Stu؍e[^]ÐUWVSE1ۉƿyt&ƿ} tƿu 1:PPX~YtPH `PtC吉؍e[^_]ÐUWVS}WaS)S(1ۃ 9^~#T RrOjjPC9^jjW e[^_]UWVS]E ޿}޿ tj޿tWRRPSURe.xxPt>j_Shhe[^_]ÐU4WVSu =>GE#t$F>(t h脄F>,t!>t<w h]F>,u+SWh誉_ƃF >$~{F>(t hF>)tFuhJу吐+SWP_D+W裼Ã}Whe胃jjSPP苈_0щȃFFG>t >)Ft8$t/u hЂ?t?$u8{t h袂?}t*u hl?}u֋+SPW讇_D+W?Ã}WhjPS艻PW"_0щȃ1F>(t h贁F>)t!Fuh蔁吐+SWP؆_D+FWbÃ}Wh.BjjS豺0щȃ+ =~ hLWP_0щȃFG+=~ he腀>=x~P}Wh~X_[^_]ÐUVSH0t#8&ujCP@Pu [u߃9~̍e[^]ÐUjBƀnP@]ÐUSjBÃot hpt ̱xx unt hm]]ÐUxx u h?T_]US/hi9~]]ÐUWVS]URhh詃_9hhhjhhj_hmhhy_Ãu"=9~hhho:_ShhSy_ tVhhh} =9R5trVh~_FPh~_F(Ph~_1f~T,Rh~_C9|F&Ph~_uhp~_=tRhS~_=tRh6~_=tRh~_=tRh"}_=tRh6}_hP}_1ۃ9~!RhR}_C9119~"RSÃG9=SP=9~HhVZ}_=t(RRha4}_ ;uhj}_1e[^_]UWVSEEURE PEw$@Ѝ@P0pExEREPhl>EREPhEREPhh `[v_58u E=EPË581t FO)ȃu fC(x58u fC(T=80хuQy_ED,8PD,Pf~_E9E2E=EPË581t FO)ȃujeCP58ujrCP58 ujiCP58u jlCPa58u jcCPA58u9jeSjrSjiSjlS jcSE58u C"R8Ph"h `s_E9Er58Nu E=EUR Ë58R1t FO)ȃufC&&58UufC&EE9E|\58Yu E=EURKË58]1t FO)ȃufC*&58`ufC*EE9E|80щʃU~؍pduD=80хuQu_E-=80хuQu_E=80хuQGu_E=80хuQu_E8PRd=80хuQt_E.=80хuQt_E8RPy_e[^_]ÐUVSutVSy_uht_Ã=tǃVSYy_fifSkS fC(fǃfC&fC*؍e[^]ÐUWVSDž|MQhho_x u =9~hPht_ = thha= u/81ۃ=ltSlxx0҃RhxP[x_x C>uEPh"hw_ |ug=t^10уQEPRw_x u| E 9F|u;u0ҍ}҉ӃE 8$Phhhhhhhhhhhhhhhhhh%Pjv_ Lj~0ҿ։x;u҉xƂhhPu_EPh2v_Dž|jteDž|YEPhv_Dž|>E EPhu_Dž|11Ҁ=tR\uC,~uƂ BCCBuƂ|h[^_]ÐUWVSu > t> uE E 8 t8 tu|E 8<uxE 8"u"@E Fu8"E 8 u@E u~VE 8~uu\F2u >$Fu >(tPhhh.o ] ;t;)t3E u >t>)uE 8)t5Vhhhn SE )؉ÍsVRxPn_ D+E xuhEPk_}"xPk_Ãt+SuVs_0щ΃u7xPhOo_E uE Fuu >"aE <vE <vu >,u"E @EE uE F 2u > uE @EFu E uE Fuu >u> t> uM|9EwuFh[^_]ÐUW888 t88"t}%K80=8Ѓ8Px uJ: t:"u 1}]ÐUWVS1ۃ}tE} ?/tWhhl } 0҅uRl_E}E P}Wnq_hjxVEP?q_Eue}<WpÉډ0щMʃuRk_E}Sj/h1P}p_EU>t_:tZ9t2:t-8u'tBt;/usC;u0҅uRi_E}VPo_e[^_]ÐUUM :t9tB:uȈB]ÐUWVS}k0Ѓ uP i_ÃURjj/Vh:Sn_Sjm j/VhDSm_SjTe[^_]ÐUWVSuEhjie_EjE0}Ѓ uPjh_E=t,RURm_uE;u߃}uURVFj/URhMURm_URVFj/URhWURm_(URVcURc_e[^_]U WVS}u d}W1:99j} Wh9訮jS:'P蔮:@d:JflfnP:@[N:Hf=of8U9a} WÃ{:99jWh9jS:'P:@d:Hf=qf8:@[N:JfsfuPP}9=5vR} WURà :9==9jU Rh93jS:'P":Hf=xf8:@d:@[N:Jfzf|P19`~EEu}9 uU RPj_,uC9`j} WUR2: u15:'} u}W!P:'Pnj_ =`B``kUD$:99ց(~19`~$19t$st$],C9`EU R)Pi_}| D$(5:A󥡰:e[^_]ÐUWVSDž}uE PMQ7ÃOEP QDžtM0҉Rc_SPAh_Qà u19hE PMQ8hPM QEP81hQE PMQ8hQE PMQ\8Ãt"dSE Ph_M QPLSi6jM QSQÃtrtCSY{SYu$Dž:AI19~'P ^_B9ۉ`B9s19~&Q]_B9ۃu 1 :[^_]ÐUjU RURNu1]ÐUS] hSMQ5; u16jS;'PP;1҅tƒ'Ћ]]ÐUWVSj`_E;ujh 0ۋ}щMQ`_E ;B ;Myu }щMQhq } щMQ6`_E ; ;M9u } щMQh uV;pVae_E P54;PHe_e[^_]ÐUVS195~M;;t7xt @P[_8t Px[_Rm[_F95e[^]ÐU塐]ÐUE;]ÐUWVS} 195~9;W@PXd_uF951e[^_]ÐUS]9u\LS?t*1ېG@…tB'PBPlC␐؋]]ÐUVS]u VSuCt CUCe[^]ÐUE@]ÐUUR@]ÐUUE D ]ÐUS] MQ@1҃9P~9\ uS' B9P1]]ÐUUM =tu$19B~9L u]Ð@9B1]ÐUWVS} UR1ۃ9^~8T R'WP\b_ uD C9^1e[^_]ÐUtURt]ÐUWVS]Sǃ<ljSWEM9O~kUT Rƃt619^~@QT RW C9^ML QW"EU9We[^_]ÐUWVSu} WHtGPu~:WPVR It#PQSV uWSѐe[^_]ÐUM1Ҹ9t ,B ~1]ÐUS1;uS <,@ ~=t1,|uh]]ÐUS]K?19S~4| t&9t"D 9D u9uD B9SIy‹]]ÐUWS] EE0҉߈1҃t2E8u#B0щȃ9r1e[_]ÐUWVS1EPGÃu 0DSh>E Ph?Z_Sbƒ~pFGÅt0u19}+] SpPNlmG9|1`[^_]ÐUVSu] V[tShL=VL=؍e[^]ÐUWVSu ujEPj:UR Ãtv;td;tC;>uPVUR>C !SURbuPV]_0Ѓ:Ft ;p9utFe[^_]ÐUVSjURRY PRƋ|RV &=tRV ;ue[^]ÐUVSjURR Ƌ|RV~ '=tRV_ ;ue[^]ÐUWVEƿFtrƿN t_ƿXtLƿ`t9ƿet&ƿltƿpu1e^_]ÐUWVS}xRW[_u 9v1e[^_]ÐUWVS}RW[_u 9v1e[^_]ÐUWVSuxRVK[_t$9vRV'[_u 9v1e[^_]ÐUWVS}1۾xRWZ_uCv׸e[^_]ÐU]ÐUS]| 9|huhAhhx]]ÐUU RURh+U]ÐUWVSu01ۃt/>\>\>M W:~vPhh>Y_ѐ>>뺐0ЃM BރU$ȹȹhȹȸȹȹȹȹȹHȹȹȹȹȹȹȹȹȹȹȹȹȹ(ȹȹhȶȹȹȹȹȹ(ȹHȹȹhȷ(ȹȹȹȹȹȹȹȹȹhȶȹȹȹȹȹ(ȹHȹȹhȷ(f f >]f f >  >1f f >f f >f f >  >f f >  >f f >f f >  >qf f >]f f >  >1f f >f f >  >f f >  >f f >z/tBL+@C8/t ~D+EPhKf f >]f f >  >1f f >  >f !f >f #f >f %f >f 'f >zt)z/t#rL+ `PtXFC>t>/uD+uVH_w90~,VH_Ph)h>S_CM 1>e[^_]ÐUWVSEEEu0ҋ}1ۃtEEPEP%ƒtEPRVN_ u]}0щȃ9rEe[^_]UWVSM QMQS_u,uM Q2MQGÃt.M Q5ƒt9M Qj:5u }G?t?:uM F>t>:uM QMQMt}OMNM >t?u>%\SMQӼÃMQh1MS_ËM Q証19S~ 9D tB9S1e[^_]ÐUVSu] ;%u S覭;*uBCPVu>Wj'PVPh>Q_6}u:1Ҁ;:t;t؊>@B8:t8uƂ>> ؍e[^]ÐUWVS]}uM M1҉؀;t,8 t`?@B8tM8u8t tƂ`?t8uD`?e[^_]ÐUWVS]} ?*t\PWP_EtFjh`WP_ t2jWSyƃ t 0҉t V7PS(e[^_]ÐUWVS}U R誺V~/{Åt!CPWP_u7V7tPWÃu 8u1e[^_]ÐUU RUR`t ]Ð1]ÐUWVS]} j/WO_uj/WO_txWStO_0Ѓ~+؉ƿetƿhuSNe[^_]ÐU=lu!l%lH ll]ÐUWVS]} 9uW|RN_u|CWhCN_WS#t?$tU'PSj1ۃ9^~4WT RM#t#t'PC9^΃=pu he[^_]ÐUWVSM |CM QhCM_1ۃ9p~C?0tMQPM QMQU$"UC9pe[^_]ÐUWS]jG_p?ujh0щMQG_E p? ?M9u0щMQh|Sp?PL_pe[_]ÐUVS195p~9?;t#8t PC_RC_F95ppe[^]ÐUp]ÐUE?]ÐUWVS195p~r?PMQK_t-P=NjMQ2P1҃ 9P~$9| u#B9PރF95p1e[^_]ÐU WVSEEE9p~M?A80щMQE_ERPE5K_ EE9pEte[^_]ÐUVS19t~APlA_C9te[^]ÐUWVSp9tt1EM9 pE?M019t~qAQMP J_tR}t@QoƋMP`P1҃ 9P~9p tB9P~9t u9Pu C9t9t+EEM9 pEe[^_]ÐUWS]=thjShh1} tP蟘}tc0ЃPC_j/ShWH_jWu<_t"Whh `~?_W?_S荏}%Shvh_h*P輐g uh2h<`hRR膐g uh[Yhdh|RVg uh)hehR&g uhh(fhRg uhhPfhRƏg uh hfh,R薏g uh5lhghVRfg uhahhhhm^uh;hhYhdJ0uhhhh] ]jSh]g Q{t3}]t M 9H$t& M N$VR gQ#tu1e[^_]ÐUS]SUUjEPhjEPhgRouSgRe]]ÐUS] UUjEPhgRnumjgRou]h(fjgRq uBSLfR!uh(fjgRs thh `_]]ÐUEffEjEPh gRmt]ÐjgRou 1]Ðu ]Ð]ÐUhfjgRp|f]Ð1]ÐUSE]f@HfjU RhfdjShfdhf]]ÐUS]=uh<] gQl<]jCPPd Pt}At SR gQ?qu1]]ÐUU UUUjEPhjEPh%gR(lt1]Ðh]gRou ]]Ð1]ÐUS]SUUjEPh3jEPh<gRkuSgR]]ÐUhfjgR&p tPhJh `_]ÐUS] UUjEPhwgRkumjgR@lu]hfjgRn uBSfRuhfjgRwo thh `_]]ÐUWVS}]u=ejU Rhe#bjShebjVhf bU$f$WuWhh `_@Hehee[^_]ÐUeUejU RheaEUjEPhjEPhgRi(t]ÐjgRju 1]Ðu ]Ð]ÐUhejgRVl|e]Ð1]ÐUS]=uh] gQh] KHjCPPg`jC'P'PS` Q_}tA uSR gQmu1]]ÐUS]USUS'UjEPhjEPhjEPhgRg(uSgRD]]ÐUUUU UUUjEPhjEPh jEPhgRwg(t1]Ðh8^gR u 8^]Ð1]ÐUS] UUjEPhgRgumjgR0hu]hejgRj uBSeRquhejgRgk th%h `_]]ÐUhejgR&k tPhFh `_]ÐUS]=xuh^ gQex^x K'H'x@(xK)H)x@*jCPxP]C0PK,Qx,P+xKHPZ}t< uSR gQ/ju1]]ÐUS]US'USUjEPh|jEPhjEPhgRe(uSgRd ]]ÐUWVSu }]UPgURhwg_ygzgjVhXgX\WURh|g URu.URhh `_h|g /@HTghPgh|g ؍e[^_]ÐUS]UPgjU RhXg[Shwg_PgUEXgEwgjEPhjEPhjEPhgRcSjCU0Rhe.SUddeeUeURee eNeeNeeNeU e e eN eeNeU,eeeNe$U Rh`eVt/0tjPVhheIR hehdh`e؍e[^_]ÐUVS] uu u1U_h_-}oEPEPEPEP`R~]~uURUR `h_j gRh^%؍e[^]ÐUS]jSZu U RjS\]]ÐUj_D_]ÐUMQ _HQH QPRQHQ@PhxhH__H_]ÐUMQ0 _HQH QPRPRQHQ@Phhp_@_p_]ÐUUR_PRPRP R@Phh___]ÐUWVSuE} t'0} Ӂ~E1ۅ~Z^P_u%FPhh `]_F5SU RP_}tDFe[^_]ÐUS]t{t;tP_C]]ÐUS]t f{~;tP_fC]]ÐUVSuVh _~,uhh `q_e^,ZSh8_hG_hX_C%<t t5C<t:hahihuj_C%PhU_{$uPh7_S(Rh)_{(t|SVet tGUtIS(Rh;s,s(h_ 8S(Rh Ph_ h_h_[4e[^]ÐUVSu]~f~~>tfFQ_~af^P_‰u)FPhh `_fF9FPM QR_fFe[^]ÐUWVS}1G(9p~91ېU R@DP _uG(@DFG(9p̸e[^_]ÐUU RURh& ?_]ÐUE 9E%]ÐUWVSUE M]u8%%e[^_]ÐUEPEPEPEPURE@%PURURUR&]ÐUEU Љ]ÐUEU ЋUE]UEPEPEPEPURURURURURh< hh_h]ÐUEPEPEPEPhH UR_URURURURW]ÐUhT _hw _jjjjjh _]ÐUh {_jjjjjh g_]ÐUSEU M]]]ÐU4WVSU} 0Љƃ~t tRh Rh Pv_ = u# Ph h `"_ h% S_ktC;uE PSh' P_19u ~+PhS~_ tF9u 9u 0ЉƃVRS_ t(: u CECB:uh `S1_01t CF0щȃ9r1UJ9} .CF9|0 h `P_h3 h `_P_[^_]ÐUh ` _hD h `d_MQM QMQUE8tRPh ` _hF h `*_jP]ÐUh `_hI h `_URU RUR3EPURh `_$h `hK _  9 }j]ÐUh `_hO h `t_U E 8tRPh `*_hQ h `K_jq]ÐUh `_hT h `_hV h `_U E8tRPh `_h} h `_j]ÐUh `K_h h `_E PURh `b_h `h _  9 }j]ÐU SE],tPh EPh_ EPU(RU$RU RURURU REPURh UR_ , 9 }j ]]ÐUS]`Rh h `_S_UWS= u\h _Ãt?0ЅuPp_ SP_   e[_]ÐUS]U Rj/nPh S*_]]ÐUWVS]0PSVh_e[^_]ÐUUBu 1]Ð: t: uЉ]UU 8 t8 t]ÐUWU:t0D}]ÐUWS]0Ѓxڐ: t: uJHy|tDe[_]ÐUWS]0ЃU ) CJe[_]ÐUE€8t:/uBB:u]ÐUWU0Ѓ9v8.u H9w}]ÐUS];tN9t `t#9t `C;u]]ÐUS];tN9t  `t#9t `C;u]]ÐUEuh h `+__P>_]ÐUWVSu] 0P_uPS6Vs_e[^_]ÐUSUR_Ãu؋]]ÐUh _j_UWVS]u h V_u"h E_uh 4_tu 0҉ЍDP_ǃ;tVSh W_Vh% W_ W?_e[^_]ÐU8 ]ÐU0 0 ]ÐUE0 ]ÐUS]=0 u0Sr_0 tSh@_1]]ÐUHWVSDž}t0}Ѓ0 R_ÃtMs 0Ѓ+Vh@h< R_EPR_u 1efEfƒ4 =8 ufE}t4URD; P_tE@MB 8C [^_]ÐU4 0 R_0 ]ÐUj0 P_]U WVS]1DžM tM M uO1Ҁ;t,8 u@B@8t8 t@8u։DŽ:M t20Ѓ P_SV_hD Vo__Džu[M t#jShP hS hV _-؀;t8/uX@8uPS_j_t V_jjN_jj?_ƃSv_9tuu DžQj_Vj_u t7$Ph^ h `_ }hr h `_뵐t"} uM t Dž[^_]ÐUWS]0Ѓx</ttڐJHx:/tuu ;/tt}1SPPh hh9_he[_]ÐUWU0Ѓx </tHyDPh hl_l}]ÐUU RUR_]UWVS]u } tVWSh h `z_ 5 =e[^_]ÐUE)]ÐUWVSE= t* 1DŽ=~11҃t:@~u9jh h E͐huV]]+]P9ǃ 0}ҋ= P8_t'5 Vj/uVh P+_E#hlh h ~BlP%CÃWSaAVSAV<W<ߋltttUz4t J4Q<lJWBMA4t]W<UB8B4ehlhhDhlhh%|$hlh1hO\W<L[^_]ÐUWVS]S8C49C@t9{@uhqh[hwhqhh@PK$QFu>hqhhK$  {@tK@QC$P&뫐1C(9x1@UT0|0uORWSgPC(@PSu{@YK@QC$P&&C@>|0uIRWSPC(@PSqu){@K@QC$P%C@GC(9x@{@tK@QC$P%C@1e[^_]ÐUWVSu~4tF48&jhhuM yu'0}ЉÃU Z M Q/]EPSURM QPÃu1hohh"U R] u+hoh1hEM Q\URF$P#uM Q\}WjEPjURN$QIÃu,hjhThxHV$ MQ}U zu0}ЉÃ M Y SURM Q^LËURF$P#tuhqhhMQV$RChrhhaE@PN>EWE@PMQjURN$QHÃu-hkhh9V$ MQF4V8PMQ5>Eu#hshh"oM@PV$R?ǃuhkh1hX&MQV$RBu;hrhghN$ URF$PO"MQF$P1"U@PRjWN$Q&IÃt1hkhhv$5 ?jWURM QVÃuUR6MQ61؍e[^_]ÐUWVSuU ]zu0Ѓ B PSRI tu&hqhhbv$5 1e[^_]ÐUWVSjjMQuVÃ} 9^_P_Wj_1e[^_]ÐU0WVSuURE PV# ujhh>jQUR.} 0щ}щR+ËEPU RhS_ Pj/)RhV_j0щʃRSj h@jEPj}tMQjVjNǃDS2+ujhh<>WB>hHR_ǃ u*hghKho/PURE Ph{W_W_[^_]ÐUxWVS QE PMQ^ ujhhPj/ME)PhS*_MQj@Sv9 u5hghh1 E @ 19p1ېM I|t_E P ׅ}$)tM A )ЉA M QD<v| u!؋M APOM QD E @M I LE @D M A F9qgM Q Ӆ}$)tE H )щH hP#1AE @ PM IQE Ph]S_Dž0҉ЃPSjIQP:‰0։10M 9q1ېE PL QDPLQTRhP_0҉ЃPQPIQP9‹0у,FuE 9pathkh h0AjPjIQP9ƒt6hkh<hd PhpME)P_à u9hghsh QhhP QE PhSu_S_1M 9q~S1ۋE P|t8MQ|QDPTRM QEPƒgFM 9qEE+EP 1|[^_]UWVSj%dqjjP_j%dqEP$Zu2hkhh qQ1uVjEPjSR5NjUUu*hjhhqP{fR$tVEPtQjSE@$P5ǃu?hjh,hI+ qQtP$MI$ 1tp1ۀ8 tCp< tOvCPu4hkhVhwqPtQuSpPV_ D+0҉҃pq P qQqPhV2_ǃup q QEPV_duQqz}qChkhhhjhh qQtPx#1Rd RP #dqBRd RP"dqBEDžxx9JlEh11ۋp9 tCp< tOvCPSpQlP_ D+l0҃p|PMQEPhQhlP|_ǃh0҉dR!dq`PdL2h0҉dRhP`ID1P qIED1 qIED1q|KD1 K|1tPUׅ}$)t E)ЉESD2<v|2 uCP? qRD2 qMBL0|Exx9J25qEF UӅ}$)t F )ЉF tQ qT[^_]ÐUWVS}u]?t R t919w~#1ېG|t DPp F9wWR[ WU 1e[^_]ÐUSEtÐ؋[4t P% u1]]ÐU,WVSUh)ЋP費_ƃu 1MQM Qh]S_SÁ}ԐWhV謻_Wh V蠻_u9]uۃt#t9]uCV8_uV蕺_ShhqM_qe[^_]ÐUWVSUr 1E9 ~\1ېPURf_u'PU RJ_u x>?Eu U9 e[^_]ÐUSM19t1A9u%]]ÐUWS 0҉߈tS Phh `_e[_]ÐUWVSUj)Ѝ4PEurPI_0щMQËVS/_0щȃڃJ9v:/uS_S{_Ee[^_]ÐUEM Q)‹R ]ÐUWVSh;UR_uhgh=hX0ۋ}щQ}щʃRwEPR_}щʃdBfhfBURP_щT hjP_ u+hghlhGRhV肷_ 0щƄ t t C;t; u{{t{ tG?t? uG} tRU RV_t; 0щƄ RV_/WP_Rc_ P_UR7_jjPo_PRR_EPRD_ P_Ry_Pm_1[^_]ÐU WVS1h}W_u!hghhMQhS蒵_ tF䐐}tQ)Pg}Qb_1ېQڋ}BPRhQ`_Wj/MQh>P/_(?)9} tW9_M 1[^_]ÐUWVSuU 0Ѓ]9~SRVd_3e[^_]ÐUS]1{tFjjRY_ t-jCPR_ %t Sr"]]ÐUUB< t<t< u ]ÐB ]ÐUWVSU}EtR1ۋMA(pRT tt u ] \EMA(M9H1PD2< <t< w] \2tKL2CEt Ct {t;t QC{ CP] \2tKL2CEt fCt#f{t;t QIfCf{CPs] \2t KL2KMt Ct#{t;t QCt{tKQeEMA(M9H@Ee[^_]ÐUVSu] jjjSV{Lt` tW t%=uh臶_ j_ t=t됐e[^]ÐUjU RURL]ÐUEP(q)q(q]UEP,qP-qP.q/q,q]ÐUh j脯_UWVS]u } tVWShJh `_5=e[^_]ÐUUR]UVS WW X X=u 8TUR. Ãu и|uiSSB}&jhYhqu%h}ޯ_t )e[^]ÐUS]   S-]]ÐUWVS}u ]   SVW ujhh.t CPjhh1e[^_]ÐUS]    {Pt SPRiURSUR | #jhhи]]ÐUEU R@TPu1]Ðjhh]ÐUUR]UjjU RUR]ÐUWVSE1   u MMy,tQ,RMA,VU~NM]j8_Ãu-URhlhhиfjMQSC US$K({,C0C4 }tUZ4}u]}TUMQ,1e[^_]ÐUWVSu}  )) * *u~4mF48a\GF,x4thhh+h=)V:u-jhFh_,и uPRV*à t~,t*UVuиi\~4tF48Et @F8 F8 tv4Vhh1e[^_]ÐUWVS}u  qq r rs=FwH uPRW;à tiURVWWà u!2uW!4tG48 VURVW tttjhshЉ؍e[^_]ÐUWVS}u ]    u SjWnSVWdà ؍e[^_]ÐUE ]ÐUE ]ÐUS]S@RC$P6C@]]ÐUE@@]ÐUWSh `V_E PEPh `|_hh `蝦_0ۉ׈tRPhh `k_= tzhh `D_ PPhh `)_= th P=< `t(< `9B`|@`Rhh `ܥ_ De[_]ÐUWSh `F_E PEPh `l_hh `荥_0ۋ=t3PPhh `X_Ph$h `C_= t3 PPh)h `_ PhIh `_= thN P=< `t(< `9B`|@`Rhgh `认_ e[_]ÐU   ]ÐUWVSE0}Ѓ]K9]s;/u9]t`hjԤ_EujhhCUR[_uC/jhh9hjt_ƃujhh 0҉PZ_ǃu1hlh!h+1SVh8W+_jW۟_t$jh>hVjW訟_tjhchvFjW舟_tjhh&}t*UR_ujhh819]tC/e[^_]ÐUWVS}1ۋG(9X~91@D0PW,R蟫_uCG(9X̸e[^_]ÐUWVS}G(p EM9HEP}D:<v|: uzMD < tB<tg< tLW] }\:C;] M\ C] }\:sEEMA(}9xVMyPt yPWVMAPEA(@ P} WMQ"_ }G(H ME}9x1PD2<v |2 D2< tX<t"< tl] \2CP Q}W蘤_ C.] \2CP Q}Wh_ Clj}*] \2KQ;WMQ9_ []E}G(M9H e[^_]ÐUWVSEMA(M9H~a1PD2<v|2 u7D2< t<t'< u] \2;t ShEMA(M9HMqPA(@ PVM Qj_ MA(p EM9H1PD:<v |: D:< th<t"< ] \:{CPuSRVPע_ C;] \:f{tbCP8SRVP蚢_ CƃB] \:{t#KQKQVP]_ sEMA(M9He[^_]ÐU WVSUB(JPH MEU9PnEpMD<v | 1UD< tv<t < ] M\UBPD@8Ct3}KCE] M\UBPDf@f9Cft3}KupCEp] M\UBPD@9CuKt3}u9[]:MA(@qPUt} |D t EEUB(M9H1e[^_]ÐUUR$_uhh `_j?_]ÐUEP_]UVSu]CPU RV藥_3e[^]ÐUVS]u{t;t RtSVPVU RP賟_ Ce[^]ÐUVS]uf{t;t RAtfsVVU RPS_ fCe[^]ÐUVS]u{t;t RtsVVU RP_Ce[^]ÐUhjjI_hjj._]ÐURj_=tj̛_P趝_Rjݢ_=t j袛_P茝_]ÐU]ÐU]ÐUWVS}} M9U :M9U :MM Pƃu 1EU 9:|VUM9|0MUMU9u MMGECU9}܃EEUM 9}t"O>VVݘ_"VƘ_je[^_]ÐUWVS}} MM PEMQMQM9M 91|dMM M1ҋM9~&MM MM9u@u9E}~M MMGEFM 91}t%OM9QËMQʗ_MQ賗_1e[^_]ÐUU @PRMQ赛_]ÐUWVS]u ;LV>PRQ_63e[^_]ÐU WVSuEEE} 9|Y}<}9|F9tVA9| 9u9};E8EEEEE} 9}e[^_]ÐUWVSU} uRh_e?uPQRhƛ_9|.wQ ~ Ph 藛_ C9}h 肛_e[^_]ÐUVSuR ÃtVS`؍e[^]ÐUWVS}4Vƙ_ÃuWh _ VjS_؍e[^_]ÐUWVSuU 9|9VtFC9|9u9}1fHPgE9}MV:9@9|C9| }9:C9}6N}7Ee[^_]ÐUVSMu ]9|!A9u0B9}e[^]ÐU WVSMyQRh ܙ_EEPMI QUR$RMQURRMQEtO}UUMq$19}%>tRNQSh m_C9|ރ}t$h 6_e[^_]ÐU4WVS}EE} .WhE} }EPO QO$QMQOQWẼ3}u_$u_$u19M 9K|u M؋C+E = v"E E܋E 0K)MM EEKMjEPMЍPOQWVEB9wMMЃ}u }W}unOM؋GE GM MEEEEW t-!WFSW6CER"EEEEEPMQWuEE؍e[^_]ÐUVS]RD_{$t S$R肑_Sy_e[^]ÐUEU uSt:u* "Q "Qh `_]Ð "QR ,"Qh `_]Ðxu=< `tR7_]Ðt:u@!P뇐@!P뚐UDWVS}] EPSW 9_uGM}~EPSW}u}t*SWuEPSW p]ȋMM̃hW@GCWtOQW&G$G$@jO$QjOQWWWZEPOQW E9Ev2jEPMQOQWrEPO QO$QVOQWEBu_$Eă_$E19}]u;uGjEPMQOQWWW1EB9|}uuNMɉMԋ_؃ȉGER"MMEEEEPSWZ tfSOQWw* tSjuVMQSW&t:OMȋMMjVMQSWt_WWWe[^_]ÐUWVSu] }u FJjSRY_ 9u.jWR藓_tӃu!?R"u1Fe[^_]ÐUVS]="u{u 11jjSRR(u"e[^]ÐUE="tjPRP("]ÐUSj(腐_Ãhn_C$C MQE PMQV_‰ |kjCPRo_ u)CR"CCCSu/{R"u&CC CSڋ_1]]ÐUVSu] jSR蚏_ 9ujURR=_tF1e[^]ÐUWVS}]uEEPU RW tq9E~E9E}u)ޅ~/jU \SR_ 9tG-VUR?W'_U92u E e[^_]ÐUPWVSu0EEPU RV UȉUtE}̃tÀ}tEPURV tEPURV tj}tỦUtUȉUEEEPU RVT t0tEPWV= t}tEPURV!u1e[^_]UWVS}uEPM QW t9u| E9E}Gt}~*jUM \SRM_ 9tGVMQR_ 9uE9E}EEPM QWYt1e[^_]US]jjR_ ujCPS舕_t1]]ÐUWVS}W& E?tRO_}E@t W@R芈_w8t^ VRt_Vn_ރuW__Ee[^_]ÐUWVS}uG 9vG  GWVVU RW!uW]W$JUG@ЉEPWE ÃuW&SREPEPWRW(RVU RuWduG W>GU9W,upCx ug@C@SW uWzG$W u WQWJ!Cx U9W,tx xjW ƃuWtVRSRURSVCSWD tVW5 uW GW 1CUptPRWu ÃuWV CpSW uW. tKVW Ãu W xCUSWj uW SURW t-MG@UDEG@ЉEPW ÃWg e[^_]UWVS]} uC 9vC CS VWSr}S$C@TRS teHKC@PCPMQKQK(QVWuS 17tKS C S e[^_]UWVS1UB@J,UB@PRtǃt0MAD9u2ADADPQ@R_MA@u_{uGOUJ} uG@ BUBMA1X} t{ uFUB@[:FMI@CGP)‹C e[^_]ÐU,WVS] }G 9EvG}MA}W MQSWTuW}O$IMG@ȉEjWEu W`}}MA A Q )Ћ}GE܋MQS}WI_ MM}GMQWxƃ~WEPEPMIQ}(WMQ}WuMA ^{}u}GVCFP)‹[ ‹EM V}W-tMQWu}W%MAQ-Fx @UM9Q jQQÃ{WNQ}WEPMQ}WgNKFV}W} t!SWntMQW\u}WfMAQm}W'EjWÃjWEԃEPMQ}ԋWKQ~WMA A P}WEPMQ}W>MԋA}8QF@BSFFE؋CMH}{}ԉOF(VMQZ>S}WD(MQW.}t<}WMQƃF}xVMQ}}}M9y,QEԃjMQ;ƃj}W#ÃvF@F@ F@FMH{WNQjEP}WMQF}ԉ{SMQ$ }WMQ V}WMԉO,G$GWGW>1M}G@MDEG@ȉEPWƃM}9Ot5}MA A Q )Ћ}GEVMA A Q )Ћ}GEOM!t V}W}tMQ}WMQ`e[^_]ÐUS]{tjjR諀_ ujCPRN_t C1]]ÐUVSu^8tH;u;{t5jSRRK_ 9CuV RSRR_ 9F t [ u1e[^]ÐUSMU zu9Q8} 9QW}_ 9Cű~ W{W>W+_ 9F uSV]1e[^_]ÐUVS]u VSƒt5BK0B@RS)ts0CSDe[^]ÐUVS]{0us4S S4#S0RSfts0@C0CSte[^]ÐUEjjjjP]ÐUS]SjjS{]]U(WVSEEEEEEE;E1jH|_Ã5CCU u"F$Č$DTdtzJMEJMEzJMlJMYJMLJM<JM܃JM#JMu JKrMQMQW{_ SjCP Q|_ƃMQz_ǃMKMK MK(C$MK,C0ɉK4CSluG GGGjMQ Qy_ 9EuMQW Q藂_ 9Et1Wu_M9KC$CDPy_C@C81E}tMQMQSv }uaEXj]y_Eto{8uC8MqAA K Q*y_MAt9tN uM}uMK1Y]9]@u} 9G u'w]3(}}e[^_]ÐUWVSUEJ A}O M JO JOJOz}]BЍHM)Ƌ}GH)MR E ȉEEE}M9y M9Mu`}uZ1ҋ} 9}}M ECB9U }u M } }M OE} }M9M9M}u*1ҋM9~FM ECB931M ECB+F9|EM}}}}E}EM}9O e[^_]ÐUWVSEE} W J}W } }} W}W} W}W}] } GPU)EU9W }9}u8u19>~ CA91ɋ+F9}CA9|M_}u*1ɋU9~G}CG}A931}CG}A+F9|E}U 9z U}U 9z uztz)U z+}UzU BЍx})ƋUBЍx})ËU R } ؉EE}U 9z ~wU9Uu}}SU B H9Eu$zt}9z u9Uz#+U}}EU} 9W e[^_]ÐUWVSuM }y u]1Y]AȍP)‰Ѕu+\DE]99AȍP)‹I Ћ4]3?W]S]So_1e[^_]ÐU(WVSEEEE}}] MAȍP)‹y ‰UM A}GP)EEG 1M9Mu8}u219U ~M ECB9U } }Eo}u*1ҋM9~M ECB9>}61M ECB+F9|+FEE} utM؋}D9EseM y}Gy M؉M}t} O UM)щO}(t,},BM(M܉ƒtK }܈O}Ju]$E؋MA @9E}u}؋M +y M$y E؋M +A H}$G EM +A+E}$GAȍP)‰U܋MAȍP)Ƌ}  ]EEEA -M9Mux}urE}9}u&Myt}} OE}?;}t E@9Eu } M M܋} y9M MX}9}u(Myt}} OE#}?;E}>M܉9EEM9Mu@}$GP)‹O ÉU܋E} G)EMyuGE؋}G @9EMyM$ye[^_]ÐUWVS]u S{u"uPSC{WS,uCKu QC9B ~{uA@AC{tBSRSuC두A@ HCu{uA@ CCUUS!XURURURURIQSR?tSC1Se[^_]ÐUWVS]}1C@K,C@PStM@xu 1wPS@RC@PKQK(QWM QuC 0CD9u CDCDPK@Qk_C@tFhe[^_]ÐUVSuF$V V,F0V ҉V4FVtkjVÃtZV,SC@ C@C@C@V4RROe_tSV e[^]ÐUVSu]=)t 1jU RVh_ uh)i_jCa_}ffUfEEUUEPtPVc_ u+=< `#uh)xi_jYc_t jm_봃%e[^]ÐUE=)t1]ÐfEfEtU UEEEPjURb_]ÐUWVS}1ۋU9U u 1[EPW RW$RSU RWƃt/URW$RSURWtt]u1e[^_]ÐUVS]uC 9vC\S6jjRf_uVU RRao_ 9tS(CS1e[^]ÐUS]C 9EsC_Sjj Q>f_u C PM Q Qsh_S 9tSCS1]]ÐUS`u1=dt@ -b Build entire cluster -c Class belongs to -q Run quietly - no progress messages -DC Delete Cluster -Dc Delete class -M Maintenance mode -i Don't recompile if dependants interface has changed -n Compile only -p Preserve compiler intermediate files -r Build runtime system -R Build runtime and builtin classes -u Use alternate universe -v Set verbosity level to -x Execute system after compilation -X Execute after compilation -z Clean up cluster -Z Clean up cluster including executable file %s: cannot access "%s"%s: cannot get status of "%s"Class %s %s%c%s.e%s%c%s.%s%s%c%s.%s* is up-to-date. * needs re-compiling. * needs initial compilation. * C source out-of-date. * Header file out-of-date. * Database already updated. version: %s Source: %s (%s) Cdb: %s (%s:%s) .e Warning `.e' extension on %s is illegal VLCP: Can't find source for class "%s" Clusters are: "%s" %s: Cannot locate source for class "%s" in universen_I>," n\L4*&% tempfilesystem namecluster listroot moduleobject filesclustercluster pathinclude flagsmanifestsdebug keystargetsourceeonunix pathresponse file seperatorlinker responsearchiver responseleadin charactercc responselinker output nameranlib commandXXXXarchiver flagsarchiver commandlinker commandcc commandresponse fileXXXXXXlibrary flagsexecutable extensionec2 flagspost link commandXXXXranlibheader file extensionlibrary prefixlibrary extensionXXXXXarchiverlinkerobject extensionc++ extensionlibrarieslinker flagscompiler flagsc++ compilerc compilervendor %s%syesYyesYNbibtbasic%s%c%s%s.%s'%s' should be a list specifier'{' expected in config file'{' expected in config fileError in %{} expressionEON_COMPILEReon.cfg%s%cdefault%c%s.cfg.cfg%s%cdefault%c%s%sCompiler definitions file is "%s" rCan't open "%s" (errno=%d)%[^= ]=class.edbCan't access "%s" (errno %d)%s%c%sCan't access "%s" (errno %d)%s%c%sFailed to change to cluster directory "%s"Cluster name set to "%s". Extension "%s". .%s.%s.c.eBuilding cluster "%s". -v %d -qCan't scan directory "%s"...File: %s Eiffel class (compile). Ignored. -leon%s -L -n%s%s%s %s %s Returned status is: %d Cleaning cluster "%s". Can't scan directory "%s".e...File: %s (cleaning) %s%s%s%s%s%s%stLinker output nameCan't scan directory "%s".l...File: %s (cleaning) %s%s%s%s.%s%s%s.x%s%s.%sInterrupt! %s%cCOMMENTrCan't open "%s" (errno=%d)--insufficient memory--%N%s%cbibtCan't change to directory "%s"%s.e%s: Could not run "%s" (status=%d)%s.e%s: Could not run "%s" (status=%d)%s.%s%s: Could not run "%s" (status=%d)Adding basic class "%s" Runtime built %s%cbibtCan't change to directory "%s"Compiling runtime "%s" %s.%s%s: Could not run "%s" (status=%d)Response file in use rswCan't open response file "%s" (errno=%d)%c %c %s.emakerCan't open root class "%s"%screation%s--%s.lSpecification file "%s" does not exist. Do you want to create one (Y/N)? wCannot create "%s" (errno=%d)root %s creation %s option debug(all) trace(all) debug(on) trace(on) generate executable:"%s%s" cluster A basic specification file for "%s" has been created. You may want to modify it for your particular application. unknownName: %s Optimise all: %d Trace all: %d Debug all: %d Diagnostic options for "%s" (%d) Assertions %s onoff Debug: %s onoff Trace: %s onoff Optimise: %s -D -DEON_%c -DEON_OO -DEON_TT -DEON_DEBUGD -D Key: %s -D er... -DEON_R -DEON_E -DEON_OO -DEON_TT -DEON_DEBUGDDiagnostic flags "%s". %cWarning: VHPR-1 rule. Parent inherits itself Ancestor class: %d %d =%s%d=%sCan't find "%s" in database%s%c%s.%s%s: Interfaced has changed &%sChecking dependants "%s" %s %s Class "%s" does not existLoading cluster names "%s" Can't read cluster directory "%s".e...Class "%s" appears in two clusters, "%s" and "%s". One must be renamedalias.dir%s%c%sr.eunixmsdosalias.dirWarning: "%s" unused in %s%c%s. Warning: "%s" aliased to an existing file "%s"Warning: "%s" aliased to an existing file "%s"Internal error eon:print()VTCT: Can't find source file for class "%s"%s: Class database "%s" not availableMaintenance mode %d Could not delete class "%s" in cluster "%s" Cluster "%s" does not exist. Deleting cluster "%s" Failed to delete cluster "%s" Can't scan directory "%s"....Can't scan directory "%s"...ANYPLATFORMGENERALANYPLATFORMGENERAL%s: pass 1a failed on class %s'(' expected after '#' in config file',' missing in %() expression in config file'(' missing in #() expression in config file')' missing in config file'%s' is an unknown definitionError in #{} expression'{' expected in config fileError in #{} expression'%s' is an unknown definition'(' expected after '$' in config file')' missing in config file'%s' is an unknown definitioninternal buffer overflowinternal buffer overflow%s: '%s' The database is of the wrong format (probably due to an upgrade). Delete and rebuildThe database has not been correctly built. Rerun with the -R option specified on the command line*** Unregistered shareware version *** .lrNo lace file "%s". When reading "%s", %d errors were detectedClass: %s Assertions: %s Debug: %d %s Trace: %d Exec directory "%s" Compile with "%s" Link with "%s" Root class is "%s" Creation feature is "%s" %s Universe: %s %s "%s" has a syntax error on line %d. "%s" has a an unexpected statement on line %d. "%s" expected a text string on line %d. allonoffensurerequireinvariantloopcheckallnone"%s" expected a assertion type on line %d. allonoffallonoff.exerecreationrootclustergenerateoptioncompile_withlink_withexecutableoptimisetraceassertiondebugline: %d. %s%s ( %s ) : %s , %s , %s , %s , %s , %s , %s , %s , %s , %s , %s , %s , %s , %s , %s , %s ; : %[ -~] ;%s: Missing opening bracket on line %d%s: Missing closing bracket on line %dCWDWarning! "%s" not in environment. %s: Cluster must start with full path name: "%s"..%c%s.%s%cbasic%s%cbibt%s%cbasic%s%cbibtCurrentNN?ANN?PNN*Currentrruldgeneric_addgeneric_addgeneric_addCHARACTERDOUBLEREALBOOLEANBITPOINTERNONEINTEGERddddd2$DOUBLE_REFREAL_REFINTEGER_REFCHARACTER_REFBOOLEAN_REF%*s%s BOOLEANCHARACTERINTEGERREALDOUBLEBITvoidi >= 0 && i < bibt_list_count()classaccess.c%s:%u: failed assertion `%s' Memory allocation error in `%s' (%d bytes)\%o@\b^$\f\\~\n`\r#\t\0|L'%s'%\'\"[]{}%cNONEUnable to find class "%s" to check conformancevoid.e.txANYANYexport_addexport_addANYcdbchan == -1classlib.c%s:%u: failed assertion `%s' %s%cinfo%s: Not an Eon/Eiffel database. Can't open database `%s'classesFailed to open `Classes' table clustersFailed to open `Clusters' table featuresFailed to open `Features' table parametersFailed to open `Parameters' table suppliersFailed to open `Suppliers' table ancestorsFailed to open `Ancestors' table genericsFailed to open `Generics' table visibilityFailed to open `Visibility' table assertionsFailed to open `Assertions' table cdbchan > -1classlib.c%s:%u: failed assertion `%s' ..........********clusterclustercluster_idcluster_idClass: %s Unable to insert cluster "%s" for class "%s" EDclass_idFailed to delete class entries (error %d) cluster_idclass_nameclass_idclass_idclass_name %s REIversionclass_idclass_idfeaturecodeclass_idfeaturecodefeature_classclass_idfeatureFailed to delete feature entries (error %d) feature_classcodeclass_idfeatureclass_iddas_delete ( Features) failed featureclass_idclientfeatureclass_idclass_iddas_delete ( Visibility) failed Failed to delete visibility entries (error %d) cdb_supplier_insert: class #%d could not be found class_idFailed to delete supplier entries (error %d) supprec->class_id > 0classlib.c%s:%u: failed assertion `%s' supprec->supplier != (char*)0classlib.c%s:%u: failed assertion `%s' strlen ( supprec->supplier) > 0classlib.c%s:%u: failed assertion `%s' class_idsupplierclass_iddas_delete ( Suppliers) failed class_idclass_idgeneric_paramclass_idgeneric_paramFailed to delete generic entries (error %d) class_iddas_delete ( Generics) failed cdb_parameter_insert: class #%d could not be found featureclass_idnamefeatureclass_idnamefeatureclass_idclass_iddas_delete ( Parameters) failed Failed to delete parameter entries (error %d) featuretypeclass_idcdb_assertion_insert: class #%d could not be found typefeatureclass_idFailed to delete assertion entries (error %d) class_iddas_delete ( Assertions) failed cannot determine ancestry of unknown class "%d" class_idclass_idancestorFailed to delete ancestor entries (error %d) class_iddas_delete ( Ancestors) failed code == 'R' || code == 'F'classlib.c%s:%u: failed assertion `%s' code == 'U' || code == 'C' || code == 'A'classlib.c%s:%u: failed assertion `%s' DecNovOctSepAugJulJunMayAprMarFebJan SatFriThuWedTueMonSun%02d:%02d:%02d %s %2d 19%2d%02d:%02d:%02d %s %s %2d 19%2d%s %2d %02d:%02d*** Memory allocation failure in `set_varfield1' (%d bytes) Showing keys for table "%s": Currrent key list empty Field = "%s" Direction = ?? Type = Unique Non-unique (end / none) Unknown (%d) ANDOR Conjunction = %s Value = (0x%x) %d %f "%s" Unknown (%d) (empty) ----- *** Memory allocation failure in `set_varfield2' (%d bytes) in %s, table = "%s" %d.%d.%d.%d%d.%d.%d.%dEON/Eiffel. (c) Eon Software 1993 All rights reserved Version %d.%d.%d.%d (patch level %d) EON/Eiffel. (c) Eon Software 1993. Version %d.%d.%d.%d (patch level %d) }.e%s.e%sIn file: %s r%s(%d): ^ At end of file. . . . Compiler Error! Contact EON Support. . . -%d%s%s %s %s %s %d %d %s %c *** Terminated *** EON/usr/eon%s%c%sFreeing at zero!!! Memory allocation errorTMPTMPDIREON_TMP/tmp%s/%s.XXXXXX%s.XXXXXX%s/%s. >/dev/null-csh/bin/shReceived signal %d Core dumped %*.*s%s000000 *DAT*   %s: (%d) %s Too many databasesdi_open_dbNo memory for db namedi_open_db%s%c%sdatabases is closeddi_open_tableNo memory for table structuredi_open_tablecould not look-up file namedi_open_tablecould not open tabledi_open_tableunable to look-up index-file namedi_open_tableunable to bt_open/RO index-filedi_open_tabledatabases is closeddi_open_tableerror finding key in index-filedi_match_startunable allocate space for index-setdi_retrieve_setunable to read header in ib-clusterdi_match_startselect * from %s where %s = "%s" (unique) where %s = "%s" (non-unique) Unimplemented key typeKeyAddressUnimplemented key typeKeyAddressUnimplemented key typeKeyEmpty%u%d%d%ld%fUnimplemented key typeKeyDataWarning: key not in indexdi_find_uniquelocked record encountereddi_retrieve_setunable to read header in ib-clusterdi_retrieve_setunable allocate space for index-setdi_retrieve_setunable to read exising INDEX in ib-clusterdi_retrieve_setunknown read-flagdi_read_reclocked record encountereddi_read_recerror in `store_read'di_read_recread record size mis-matchdi_read_reccould not read extensiondi_read_recordunknown direction flagdi_traversetable has no indexed fieldsdi_traverseunable to allocate space for index setdi_traverseunable to expand index setdi_traverseunable to expand index set (key != unique)di_traverseunable to expand index set(2)di_traverseNo record has been selecteddi_delete_recordAttempt to deleted unselected recorddi_delete_recordcould not free store recorddi_delete_recordNo record to deletedi_delete_dupserror in index filedi_delete_dupsindex entry missingdi_delete_dupsUnable to read index cluster headerdi_delete_dupscould not delete recorddi_delete_dupscould not free store recorddi_delete_dupsUnable to read index clusterdi_delete_dupsCouldn't find key in clusterdi_delete_dupsCouldn't re-allocate for new cluster. di_delete_dupsCouldn't free old cluster. di_delete_dupsCouldn't re-insert new cluster.di_delete_dupscould not delete recorddi_delete_uniqueNo record to deletedi_delete_dupscould not free store recorddi_write_recordcould not allocate store recorddi_write_recordcould not write to storedi_write_recordcould not write to storedi_write_record(key exists?) Unable to insert into index %s'%s'di_insert_uniqueNo record to deletedi_delete_dupserror in bt_find index-filedi_insert_dupscould not create new INDEX clusterdi_insert_dupsunable to read exising INDEX cluster headerdi_insert_dupscould not allocate temp set spacedi_insert_dupsunable to read exising INDEX clusterdi_insert_dupscould not write swapped INDEX clusterdi_insert_dupsCouldn't free old index. di_insert_dupsunable to re-allocate a larger INDEX clusterdi_insert_dupscould not insert re-allocated INDEX clusterdi_insert_dupsNo memory for 000000 namedi_newdir%s%c%scannot access (existing) database dirdi_newdircould not create database directorydi_newdirobject exists and is not a directorydi_newdircould not change perms on existing databasedi_newdircould not allocate new file-namedi_newindex%s!%s%s%c%scould not open/create index filedi_newindexa+could not open database 000000 filedi_newindex%s %s %s could not generate new data-file namedi_newtable%s%c%scould not store_open (create) new data-filedi_newtable%s|%d|%d %s|%d|%d|%d could not write to schema to storedi_newtablecould not write to schema size to storedi_newtablea+cannot access database directory filedi_newtable%s %s %s error creating index on tabledi_newtablestore label record baddi_getschemaunable to read schema record sizedi_getschemaunable to read schema recorddi_getschemaerror copying header from schemadi_getschema%[^|]|%d|%d error copying header from schemadi_getschema%[^|]|%d|%d|%d error scanning in field descriptiondi_getschemar%s!%s%X %*s %*s %X %06Xerror in DI routine "%s": %s rcould not open 000000 filedi_read_dir0.tmpwcould not open 0.tmp filedi_read_dirrcould not open 000000 filedi_read_dir%s %s %s %s%c%sLocked - waiting. A serious error occured while the database was being processed. %s: (%d) %s Failed to open databasedas_open_dbEON_NOLOCKTable does not existdas_openFailed to open tabledas_openFailed to close tabledas_openFailed to delete tabledas_delete_tableNo memorydas_makekeySingle field onlydas_seekFailed lookup field namedas_seekdas_seekError reading recorddas_read Error %d: %s Extra information: Error %d: %s Error from STORE routine Operation system message: %s. Error %d from `das' routine "%s": %s Error %d from DI routine "%s": %s Error from STORE routineOperation system message: %s. Failed to get current directory namedas_fullnameFailed to change to database directorydas_fullnameFailed to get database directory namedas_fullnameNo memorydas_fullname%s/%sDatabase does not existdas_fullnameNo read permissiondas_fullnameNo write permissiondas_fullnameCan't return to local directorydas_fullnameOut of memory. %s: set is void s%s: set has %d item%s: [|%s%d] unable to allocate space for %d set-items $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stalloc.c,v 1.1 89/10/24 10:09:12 mjr Rel $H FREE LIST DUMP %x %d: SIZE %d ADDR %x NO FREE LIST $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stclose.c,v 1.1 89/10/24 10:09:13 mjr Rel $ $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/sterrs.c,v 1.1 89/10/24 10:09:14 mjr Rel $@!!!!!!record too smallno such recordrecord I/O errorbad record headerno record errorcannot open "%s "%s: %s $"$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stfree.c,v 1.1 89/10/24 10:09:14 mjr Rel $0"$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stgethed.c,v 1.1 89/10/24 10:09:15 mjr Rel $"$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stopen.c,v 1.1 89/10/24 10:09:16 mjr Rel $"$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stputhed.c,v 1.1 89/10/24 10:09:17 mjr Rel $T#$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stread.c,v 1.1 89/10/24 10:09:17 mjr Rel $#$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stunlink.c,v 1.1 89/10/24 10:09:18 mjr Rel $$$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwrite.c,v 1.1 89/10/24 10:09:19 mjr Rel $t$$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwsuper.c,v 1.1 89/10/24 10:09:19 mjr Rel $$$Header: /atreus/mjr/hacks/btree/btlib/RCS/btclose.c,v 1.1 89/10/24 10:08:55 mjr Rel $4%$Header: /atreus/mjr/hacks/btree/btlib/RCS/btdelete.c,v 1.1 89/10/24 10:08:56 mjr Rel $%$Header: /atreus/mjr/hacks/btree/btlib/RCS/btfind.c,v 1.1 89/10/24 10:08:57 mjr Rel $%$Header: /atreus/mjr/hacks/btree/btlib/RCS/btgoto.c,v 1.1 89/10/24 10:08:58 mjr Rel $H&$Header: /atreus/mjr/hacks/btree/btlib/RCS/btinsert.c,v 1.1 89/10/24 10:08:58 mjr Rel $&$Header: /atreus/mjr/hacks/btree/btlib/RCS/btio.c,v 1.1 89/10/24 10:08:59 mjr Rel $'$Header: /atreus/mjr/hacks/btree/btlib/RCS/btoopen.c,v 1.1 89/10/24 10:09:01 mjr Rel $X'$Header: /atreus/mjr/hacks/btree/btlib/RCS/btopen.c,v 1.1 89/10/24 10:09:00 mjr Rel $'$Header: /atreus/mjr/hacks/b+tree/btlib/RCS/btpage1.c,v 1.1 89/10/24 10:09:02 mjr Rel $($Header: /atreus/mjr/hacks/btree/btlib/RCS/btpage2.c,v 1.1 89/10/24 10:09:05 mjr Rel $l($Header: /atreus/mjr/hacks/btree/btlib/RCS/btravrs.c,v 1.1 89/10/24 10:09:06 mjr Rel $($Header: /atreus/mjr/hacks/btree/btlib/RCS/btseek.c,v 1.1 89/10/24 10:09:06 mjr Rel $$)$Header: /atreus/mjr/hacks/btree/btlib/RCS/btzap.c,v 1.1 89/10/24 10:09:06 mjr Rel $)Seek errorRecord locking deadlock$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stcopy.c,v 1.1 89/10/24 10:09:13 mjr Rel $*$Header: /atreus/mjr/hacks/btree/btlib/RCS/btlabel.c,v 1.1 89/10/24 10:08:59 mjr Rel $d**4>``*?`(+*p`@!P3FTLT[Tmt0{`8++/wH0t/90,l9E PРYРhРz9::;;```'5tFV8d8s8L=ȯ=>>`?l@@@pt|$C4?=AK|T|c|u|||_g<`gdgeg(fgPf"g-f5g?gIgUPg_gkGt}\LP TUU<LVtVDWW dpH j |  b  F a }     ! " # $ ( * +$ ,/ -: .C 2M 6X 7c 8l 9v < = > ? A C D E [1`kv"N~&  D/pD0 pD5 pD6pD8$pD:+pD<0pD>YpDBapDDgpDFmpDHspDI|pDJpDLpDHpDPpDUpD?pDVpDWpDYpDZp$.p.01 @1@12!@3/ 01234DapDbpDdpDgpDkqDlqDtqDvqDxqDz4qD|QqD]qD]qDcqDiqDoqDqDqDqDqDqDqDqDqDqDqDqDqDqDqDrDrD rDrDrDrDrD#rD)rD3rD9rD?A'C0D;EGs[~GW&H@N@TU5V#?Qd}m# 1=JVbo}&kzF = l y B G H    !!"!#!$#!(,!*6!+A!,L!-W!.`!2j!6u!7!8!9!<!=!>!?!A!C!D!E!"["K"z""""""#<#h###&!#!# #"# "#,"D*s#$('?'A(C (D(E#(O([Z((((((#)3)])z))))'*&"1*"DCsDDsDNsDRtDStDTtDY,tDZ5tD]LtD^XtDcktDetDgtDhtDmtDntDotDrtDstDttDwtDxtDztD} uD~uD%uD?uDJuDjuD|uD|uD|uDuDuDuDuDuDuDuDuDuDuDuDuDvD vDvDvDvD(vD.vD1vD.8G.9Q.<\.=f.>n.?w.A.C.D.E..[. /;/F/Q/|/////)0Y0}00&"0"D&wD'wD(wD)wD,$wD16wD7JwD;RwD-dwD.kwD>kwD@pw0$#w0#0$ 0%0@#0@$0@%00l0|w1|w1|w)1d|wL1d|wU1w11111+2o222222 3&3S3n3333m3 3333 44&424>4N4]4j4w44444445#5\555596v6667"7^7Bh7Gq7H{7 7777!7"7#7$7(7*7+7,7-8. 828687)88289<8<G8=Q8>Y8?b8An8Cw8D8E88[88#9.9\999999$:A:m:::& ":"D|wDwDwDwDwDwDwDwDw:$|w::@;@;;LD!wD"wD#wD$wD%xD&x;$ w'; -;@ 3;f4;o5;6;7;x@;xO;xa;dx;dx;;;;<<c<<<<= =2=E=^======m> >>+>7>C>P>^>j>v>>>>>>>>>>?L?[????'@q@@@AMAZAABAGAHA AAAA!A"A#A$B( B*B+"B,-B-8B.AB2KB6VB7aB8jB9tB<B=B>B?BABCBDBEBB[B,C[CfCCCCC"D2D\DyDDDD&E&P#0EP#D$xD% xD( xD+ xD-8xD3?xD7]xD:ixD;pxD<wxD=~xD>xD?xDAxDCxDFxDGxDIxDLxDOxDPxDQx7E$!xJE!SE" \E#dE@%lE@&qErEhsEtEuExExExEdxEdxEEF*FCFaFFFG)GFGbGtGGGGGH&H2HI?#IA2IC;IDFIERI~I[IIIII(JRJbJJJJK)KVK&#`K#D"xD#xD%yD&yD(yD)ygK$xwKK K!K@K@ K KBK$yK$yK$yKd$yKd$yKL-LTLmLLLM1MSMpMMMMMMN.NPN\NfN qN{NNN!N"N#N$N(N*N+N,N-N.N2N6 O7O8O9'O<2O=DO?MOA\OCeODpOE|OO[OOPP'PRP|PPPPP/QSQQ&$Q$D&$yD'6yD(6yD+=yD.SyD/\yD1cyD1gyD2lyD6qyD7yD8yD;yD>yD<yD?yQ$ $yQ Q! Q"Q#Q$Q%Q@ Q@"Q@$Q'Q(Q@)RRRyRy Ry2RdyURdy`RRRRRR6SzSSSSSTT1T^TyTTTTT TTTT!U" U#U$U('U*1U+U?UAUCUDUEUV[VIVxVVVVVVW:WfWWW&p$Wp$DyDyD$yD%yD'yD*zD+ zD,zD-zD/zD28zD5RzD6XzD7^zD8bzD:hzD<vzD?zDBzDCzDEzDFzW$yWW W@WW X! X@"X#"X@$*X%1X 2X3Xz=XzLXz^XdzXdzXXXXXYaYYYYZZ0ZCZ\ZZZZZZZ [ [[%[!.["7[#@[$I[(R[*\[+g[,r[-}[.[2[6[7[8[9[<[=[>[?[A[C[D\E\:\[E\t\\\\\]]H]e]]]]^&$^$D%zD&zD(zD+zD,{D- {D0 {D1B{D2I{D5P{D9d{D:n{D;q{D={D>{D?{#^$ z2^ <^! C^"M^#U^$\^@ b^@$i^&q^r^s^t^u^{^{^{^d{^d{^^_*_C_a___`)`F`b`t`````a&a2ab?#bA2bC;bDFbERb~b[bbbbb(cRcbccccd)d&0%3d0%D{D{D!{D"{D#{:d${JdTd@Zd[dB\d{fd{ud{dd{dd{ddd e%eCeeee f(fDfVfifffffggg )g3g>gKg!Tg"]g#fg$og(xg*g+g,g-g.g2g6g7g8g9g<g=g>g?hAhChD(hE4h`h[khhhhmh hiii'i4iBiNiZijiyiiiiiiiii0j?jujjjkRkkkk.l;lwlGlHllllmHmfmmmmnGnWnan&%kn%D{D{D{D {D!{D"|D%|D&|D)!|D,(|D/+|D04|D1:|D)<|D5C|D6I|D7L|rn${~nn@n@n@nn npnX|nX|nX|ndX|ndX|no.oUonooop2pTpqppppppq/qQq]qgq rq|qqq!q"q#q$q(q*q+q,q-q.q2q6 r7r8r9(r<3r==r>Er?NrA]rCfrDqrE}rr[rrssm1s ?sKsXsdsps}sssssssssstt!t4tytttt uQuuuvHvwvvvGvHvv w;wgwwwww'x^xxxx&%x%DX|Dg|D+g|D,v|D-}|D0|D1|D2|D5|D7|D8|D9|D:|D=|D>|D@|DA|DB|DC|DG|DH}DI}DJ$}DK8}DL8}DM=}DND}DOJ}DPX}DSX}D``}Daq}Dbx}Dc}Dd}De}Df}Dg}Dh}Di}Dj}Dk}Dl}Dm}Do}Dp}Du}Dw}Dy}Dz~D{~D|(~D}(~D9~D?~DB~DI~Dg~Dm~Dx~Dx~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D~D DDDD D#D2D8DHDHDHDZD]DjDsDDDDDx$X|xx xx@x@x@xxyy y@!yyYypyyy y!y"y#y$y<%yP&ye'yp(y)y@w0y1y2y3y4y 5y@6y?y@Hy@IyPJy`KypLyMyNyOyPyQyRySyTyUy/Vy:Wy`yoyydydyyyzz|?|A }C}D!}E-}Y}[d}}}}m} }}~~ ~-~;~G~S~c~r~~~~~~~~~)8nK'4pGyHA_ׂ@PZ&D&dD&DDD D!D"D%D&D'D*D,D-D/D1D2D4D6D9D;D<6D==D>CD?LD@LDEQDGTDIZDDlDAlDBsDCyDJ~k$v @@@@@ZZrrƒÃăŃƃσރdd;Mt3Qsх2Np| !"ņ#Ά$׆(*+,- .26)748=9G<R=\>d?mA|CDEȇ[Ӈ1<mP ^jwˆ҈#2@S݉ ?p-gߋGH+ZΌF}ɍ&&Ӎ&DDD D#D'D(ƀD)πD*D+D1D2D3 D4D6(D92D:<D>HD?TD@aDAhDCDDڍ$ @@  -dMdXz̎.rϏ)VqŐ Аڐ!"# $(*)+4,?-J.S2]6h7s8|9<=>?ACđDϑEۑ[Ap{m ’Βے -:FTbqדK~6lՕG'H1AjŖ 3]&&&DDD*D+ÁD,ʁD/ԁD0ځD1D4D6D7D8D9$D<$D=.DA7DBIDCJDDTDGTDI]DQDVDYD\DcDdDeDgDhDmDoDpDq)Du4Dv4DwQDxZDy]D{D|D}DDDDDD˃D˃DDDDD D@DDDTDTD^D_DdDdDdD|DDDDDDD DDDD#D&D-DrDxDDDDDDɅDɅDޅDDDD(D2D;DVD]D`DfDDDDD ɆD ІD ֆDDDDDDDDD%DID TD!xD#~D(D)D*D+D-D/D0$&0 8?FP@X^@ e!o"v#}$%&'@( lD`@u@'@آԘۘܘ%@@ććć dć-dć4Vhƙ Nlǚٚ2Mim śқޛ-<IVbp~;jΝUŞ=BGGPHZ eoz!"#$(*+ɟ,ԟ-ߟ.26789<&=0>8?AAMCVDaEm[Ӡ Fuˡ9aʢڢ&T'T'D=ćD@ˇDCDDDFDG $<ć< @<FDKDLDPDR$DS/DU]DVdDWdDPgDZkD[m$JJ%@J+@L2X3k456DbDmDrDsDtDuDvLjDẅDx҈Dy׈D|݈D}D~DDDDD DDDB$`Q`Wa ]@`c@aD$D3D3DTD[DdDlDvDDDDDDDDDDĉDωDDD D D<D?DBDVDeDlDtDtDwD~DDi$$v| @@@o A@FDDDDDDʊDъDDDDDD D'D)$ @@ƣǣ@ͣΣ+ϣYУYѣeD4D?D?DOD WDaDdDsDvDzDDң$4 @@@{DDD D!D"D#D$D%ŋD&ȋD'ЋD+ЋD,ԋD.ߋD-D/$@@$@*+%,5DVdvdڤU٥$7P}֦m )5BP\hxɧا>Mc֩?LBGH ŪҪ!۪"#$(* +,-*.32=6H7S8\9f<q={>?ACDE[MXĬHr?qD DD $  @ DDD!D-$@'94î4Ү4d4d40Bi(Fhư߰ 'Ceq{ !"#ñ$̱(ձ*߱+,-. 267)829<<G=Q>Y?bAqCzDE[Ȳ&1mEs̳0gڴU,8 FR_kwɵֵ (7|#T۷KzøG̸Hָ>jع*a&''D'4D)=D-=D.DD/KD0RD1YD2`D3gD4nD7uD9wD=D@DCDDDFDGDJDK DLDMDP$DQ-DR5DS<DVDDWMD]TD_`DbdDcmDftDg}DjDkDlDoDqDrDxDzɍD}DDD D D#D)D/D5D<DBDIDNDRD_DdDkDrDDDDDDDDюDڎDDDDDD$D+D4D>DEDKDNDTD[DbDeD{DDDDDDDDDDDD$'4Ѻ'@)@*+@,- ./0!1)21394A5H@6M@7V W@_`abcd̏m̏|̏d̏d̏ٻ+IѼ.J\oн$ /9DQ!Z"c#l$u(~*+,-.26Ǿ7Ҿ8۾9<=>? AC#D.E:f[qϿڿm !-:HT`p6E{X4A}GH%T@w& ( (D!̏D"ՏD'ՏD+D.D4D8D:D=.D>9D?9D@PDAWDB^DCeDDlDEsDFzDIDLDMDPDQDRDSDWDYDZD[D\D_DcDdDe(Di3Dj<DkDDlMDoTDpZDq]Dr`DsgDtnDuqDwDxDzDjD|DDDDDD‘DȑDʑ$̏ @"@#@$% @>#m$%-&0'(ԑ2ԑAԑSdԑsdԑ}S"5N{  ! ")#2$;(D*N+Y,d-o.x26789<=>?ACDE,[7fm &6ER_ky Ap[CGLHVf2X#-&h(7h(D ԑD!ݑD-D1D2D3D4D8D;*D>0DABDMPDNVDO\DPiDQlDRtDSDTDXDYDZD^D_ŒD`ƒDaɒDb̒DdؒDgؒDdڒDeDhDnDoDpDqDr#Ds:DtADuJDvLDyZD{fD|~D~DD[D\DDDD“DēD֓DݓDDDDDDDD}4DDDODT>$ԑKQ W_hs~ !!!"#$@%&@'() DdDpDpDwDDDDDDDDDєDDD DD$D/D5D;DDDODSDYDiDtDzDDDDDDɕD̕DܕDߕDD$d @ @ (/@8@=CIRS1T^mdd; <Naz  !+6C!L"U#^$g(p*z+,-.26789<=>?A CD E,X[c4` W&((DDD$D% D.'D14D2>D5JD8VD9\D:bD=zD>D?D@DAD@DCDDDCDE–DFŖDGЖDH֖DIDHDKDLDKDN&D=)DR;DVLDWQDZ`D^oD_D`DaDd—DeԗDfܗDgDhDi DjDk Dl*Do7Dp:Dd=DrK$ @@@ @! "@#$%% &;D|`DrDrDxD~DDDDDDDDɘDИDטDD DD'$v`3v8w >xGyPzY{`@ve@wk@yt@{bD D)D)D0D4D;DBDKDQDsD}DDDDșDәDٙDߙDDDDD DDD D0D;DEDMDPDSDkDqDxD~DD DDDDDDDDʚDʚDКD$D%D&D'D+D."D/5D0JD3\D5`D7D8D9D:D>D?D@DEǛDF֛DHDKDMDNDPDR DS0DU;DVEDYHD[KD\OD^RD`ZDa{Dd~DfDgD5DoDp$   $(,@@ @@!*1;EFNOPQĜ[ĜjĜ|dĜdĜ8|9K^w  (3@!I"R#[$d(m*w+,-.26789<=>?A CDE)U[`m )7CO_n{%4jG#0lGuH=[ <LV& )` )DĜDМD"МD&֜D'ߜD(D*D-D/D0D2D5D6D8$D<(D>KD?PDAdDDlDErDHDKDLDNDODRDTDUDWԝDX۝DYD[D]D^DaDf)Di/Dj6DGDDdDDbDDcJDkOg$Ĝv @@@@  ==TT@e\\\d\#d\,N`Fd*Ea !"#$(*+,-.'216<7G8P9Z<e=o>w?ACDE[DOmc q}(6ESfR @zGH>m1Y&|)|)D\D hD$jD'tD)D*D,D-ƞD.ΞD/՞D3ܞD4D5D7D;D<D= $\ @@"@ '@!-@"3 4567?N`dd^-@Y  "!+"4#=$F(O*Y+d,o-z.26789<=>?ACDE 7[Bqm  %1AP]jvL{)fNGWHaq=c.8&)B)DD D D'D-D 4D!<D"?D&MD*^D+dD,nD-xD.D0D3D7D4D8I$S]@c@jklȟvȟȟdd!Ha%Gd"DPZ eoz!"#$(*+,-.26789<&=0>8?AAPCYDdEp[Fp#G&`*Q`*D"D#D%D&D)(D,(D-AD0ID3dD5gD8kD1xD9}X$fp x!@@# @)* pudd.Un2Tq/Q]g r|!"#$(*+,-.26 789(<3==>E?NA]CfDqE}[-VIq&**DDDDD!D"D%D&D'D(D*D,D-$ !@'@. /^0p1D3D4D5*D61D98D;>D>rD?xD@DADCDEDF2$0?0E1 M2T@0Z[\]^gvdd'E *FXk ?` / V      + c   W   3 4 5 6 7 8 9+ ;6 EC l l . $   $ * $0 P P P. dPM dPY {     / s      *Wr,[|&Ps ;cWpz3456789;El6kJ Xdq},:M <m*dGH$EPE F G"H/7FXdwdY(;T0V&Pz3eW3456789;E<l`.u  #.9DOZep{  +6ALWbm}&8BQcl{   2 9 H Z d s          ! !!*!1!@!R!Y!h!z!!!!!!!!!!! ""'"6"H"O"^"p"x""""4"4"4"4"4"4"4#4#4!#4*#49#4K#4V#4e#4w#4~#4#4#4#4#4#4#*##@#LA `$P$P&$P1$P<$PG$PR$P]$Ph$Ps$P~$P$P$P$P$P$P$P$P$P$P$P$P%P %P%P#%P.%P9%PD%PO%PZ%Pe%Pp%(`x%%*%%dH%P`%$u% `%D$%`%%X`%%T&x` &L&!&.&(9&,H&H `P&c&]n&0 t& 0q&w&8`&O&@ `&&&v&D&t6&& 8q'0`'p '';' xB' |K'SV' `^'x`f'dr'''''h`'*'DJ''\(T(`&(h`.(X`6(I(yW(*i(`(`(`( (((`(D(8(`)4})t)() 5)\L)V) c) `t)4)`)dr)\)س))tB),) )`*|**p+*\8* `A*lO*h]]*pm* y* **4]* **Hb*L* `*`*`+ +P`+L3+>+d7L+( \+o+ `~+(`+`+ `+`+,+`++8++`+ `+++ ,, `',|3,XC,T}V,`^,u,h-Bv--\--`--T&-$x- `-8-<..1$.X`2. <.P.`^. j. `s.@. .`.P.Hi....p.P/4S/`!/P,/ `4/4V>/\U/n/:y/|/ȱ// `/l `/`/@`/h/TN//< `/d `0 ` 00<,0>0P0Lh0e{0t0 `000d00i00p0x`1(`1``01Hj?1txP1r]1Ĝj1x11`11@1`11 1p1 22`%2Y32>2`U2}d2 p2\2]2|2H[2 `22242h`2tW23\/3XY938`F3LW3l3T<y3@`33x3`3 3h3`3 33h3$%3{4,48-464,E4$Q4~Z4f4jr4X|4 4P4tK44\444<4455l5,5i?5H`Q5` `Y5``b5s5`}5j55`5i5 `5$255 55|55W6L!696DxL6d6h q6(V{64@6$66 m66$g6U6 6 6 66$.7`%7=7G7 Q7nY7f7DKu7`77@`7 `7 `777 77z 8,m8(`&8j.8 X98B`C8L8Z8nd8Wq808f8de8x `8<8h`88X`88X9929B9W9a9xl90}9H9 `949 `9 9999:H: :`): /:o8:`B:R:Рd:|{:x:`:w:t:D8::P:x]:v:P`:X`;;&;L8;E;`L; U;Sf;\ `s; @y;;s;;;p`;@;;X|; +;;d<`<<,<`H<tW<e<'o<` v< <|<\<|<<$<P`<4<<B=@` =#=@+=XT5=`==(`N=fX=hi=<x=T==t= =`=X]===x=4 = >J>#> 1>`9>U>e>p>>|>`>$]>ı>*>0>`>>(?`? ?S? `)?]5?lP?d}a?m?!w?H`???lm?p`?V??*?\@0`@}@X)@ 3@H;@M@c@t@k{@@H@X@`@@ @h@ @`@t@ `@hAD}A $AT)1AOj $xxtxtt @lPClP) ]]ÐUS]UjEPh RRrtajRRsu 1;t *SjRR]u| ]]ÐU= uh0CRRq 0CEjEPh RRqt]Ðj RRru1u]Ðu Rj RRttυu @]Ð]ÐU= uhCRRp CUUjEPh RRpt1]ÐjRRrtۅu׋ RjRRs|  ]Ð1]ÐUWVSU RUR=ǃt W=}Å}tCPh+ _sVW]~搐sVW5 ~  搐sh0 VW ~ᐐsh2 VW ~dᐐh4 SW ~4oᐐW ~ 琐Wt쐐W ~琐;1e[^_]ÐUWVSu(]UUUUU UU,UU0UU4UU(PjU Rh0PejURhOPejh6 hPenPoPUpPqPrPNsPNtPU}P~PUuPvPUwPxPyPNzPU{P|PUPPPNPPNP$U$RhPv$t/0tjPVhPd Ph(PEhP$Ee[^_]ÐUS]8 (PSu}8 ]@HBEjEPh< jEPhD  RQlu3j RQmu1!u  ]]ÐUh(PjRRo|(P]Ð1]ÐUS=P uh(DRSkP (D]]] ]jEPhT jEPh] RSkuMjRS mu8P SjRSn | P QH `Puω1]]ÐUVS]u =h uh,ERR4kh ,EjVh Pbh ]uUUjEPhl jEPhq jEPhz RRj4uCjRR!lu.h RjRRm|h 1e[^]ÐU = uh0FRR\j 0FUUU UUUUUjEPh jEPh jEPh jEPh RRj4t 1]ÐjRR>kuߋ RjRRm| ]Ð1]ÐUh(PjRRfn tPh h `s_]ÐUS] 4GjCPhh4 hhJ hU լ^uhs hh h 責0uh hh h 腬0 H HjShHW 0 Q{t3}]t 0 M 9H$t& M N$VR SQdu1e[^_]ÐUS]SUUjEPh jEPh SR_uSSRe]]ÐUS] UUjEPh SRu_umjSR`u]hQjSRub uBSQR!uhQjSRc th h `_]]ÐUE@ ,R,REjEPhD  SR^t]Ðj SR_u 1]Ðu ]Ð]ÐUh,Rj SRva|,R]Ð1]ÐUSE],R@H0RjU Rh4RRUjShSREUh,R]]ÐUS]=P uhH SQ]P HjCPP PTP  Pt}At SR SQau1]]ÐUU UUUjEPhT jEPh]  SR\t1]ÐhH SRou I]Ð1]ÐUS]SUUjEPhk jEPht  SRe\uS SR]]ÐUh,Rj SR` tPh h `_]ÐUS] UUjEPh  SR[umj SR]u]h,Rj SR^ uBS0RRuh,Rj SR7` th h `E_]]ÐUWVS}]u=,QjU Rh4QRjShSQzRjVhrQmRUQ$WuWh h `_@H0Qh,Qe[^_]ÐU ,QU,QjU Rh4QQ E UjEPhjEPhSR[Z(t]ÐjSRn[u 1]Ðu ]Ð]ÐUh,QjSR]|,Q]Ð1]ÐUS]=$uhjEPhCjEPhKSR7X(t1]ÐhISR u I]Ð1]ÐUS] UUjEPhTSRWumjSRXu]h,QjSRZ uBS0QRquh,QjSR'\ th]h `5_]]ÐUh,QjSR[ tPh~h `_]ÐUS]=uhJ SQVJ K'H'@(K)H)@*jCPPMC0PK,Q,P+KHPZ}t< uSR SQZu1]]ÐUS]US'USUjEPhjEPhjEPhSRU(uSSRd ]]ÐUWVSu }]URURhR_RRjVhRLWURhR URu.URhh ` _hR /@HRhRhR ؍e[^_]ÐUS]URjU RhRLShR*_RUERERjEPhjEPhjEPh SRjTtfFQ_~af^P_‰u)FPh!h `Ŵ_fF9FPM QR_fFe[^]ÐUWVS}1G(9p~91ېU R@DPϽ_uG(@DFG(9p̸e[^_]ÐUU RURh^s_]ÐUE 9E%]ÐUWVSUE M]u8%%e[^_]ÐUEPEPEPEPURE@%PURURUR&]ÐUEU Љ]ÐUEU ЋUE]UEPEPEPEPURURURURURhthS_S]ÐUEPEPEPEPhURػ_URURURURW]ÐUWVS]u }tVWShh `J_5=Te[^_]ÐUE)T]ÐUWVSE=t*T1DŽ=~1T1҃t:@~u9jhhE͐huV]]+]TP9ǃX0}ҋ=P_Xt'5Vj/uVhP_E#hlhh~BlPCÃWSAVSBVL=WF=ߋltttUz4t J4Q =lJWBMA4t]W<UB8B4ehlhhDhlhh%|$hlh1hO\Wv<L[^_]ÐUWVS]S8C49C@t9{@uhqh[hwhqhh@PK$QJGu>hqhhK$  {@tK@QC$P&뫐1C(9x1@UT0|0uORWSgPC(@PSu{@YK@QC$P&&C@>|0uIRWSPC(@PSqu){@K@QC$P%C@GC(9x@{@tK@QC$P%C@1e[^_]ÐUWVSu~4tF48&jhhuM yu'0}ЉÃU Z M Q]EPSURM QQÃu1hohh"U Rn] u+hoh1hEM Q8]URF$P#uM Q ]}WjEPjURN$QJÃu,hjhThxHV$MQ}U zu0}ЉÃ M Y SURM QLËURF$P#tuhqhhMQV$RDhrhhaE@P>EWE@PMQjURN$QHÃu-hkhh9V$MQF4V8PMQ>Eu#hshh"oM@PV$R%@ǃuhkh1hX&MQV$RCu;hrhghN$ URF$PO"MQF$P1"U@PRjWN$QIÃt1hkhhv$5?jWURM QVÃuUR6MQ61؍e[^_]ÐUWVSuU ]zu0Ѓ B PSRSJ tu&hqhhbv$51e[^_]ÐUWVSjjMQuVÃ} 9^uhrhShm`@PUR$R6ƃuhlh|h1@PWjVUR$R@Ãt0hthhLMI$ .jVURM QUR ÃuW-.1e[^_]ÐU@WVS]u 0ҋ=PK_ǃuhlhh Rj/ShW'_jW׈_u jWEPS+_uO=< `thghhDsVS_uqhghNhr XfEf%f=@thgh|hVS_u!hghh"%PW_P_W:_1e[^_]ÐU0WVSuURE PV# ujhh >jQUR.} 0щ}щR+ËEPU Rh S蕓_ Pj/)TRh VT_j0щʃRSj h@jEPj}tMQjVj%OǃDS+ujh h< >W>hH XR菉_ǃ u*hghK ho /PURE Ph{ WZ_W贈_[^_]ÐUxWVS QE PMQ^ ujh h Pj/ME)TPh S_MQj@S9 u5hgh h 1E @ 19p1ېM I|t_E P ׅ}$)tM A )ЉA M QD<v| u!؋M APOM QD E @M I LE @D M A F9qgM Q Ӆ}$)tE H )щH hP1AE @ PM IQE Ph ]S蒐_Dž0҉ЃPSjIQP;‰0։10M 9q1ېE PL QDPLQTRh!P_0҉ЃPQPIQPY:‹0у,FuE 9pathkh !h0!AjPjIQP9ƒt6hkh?Eu U9 e[^_]ÐUSM19t1A9u%]]ÐUWS0҉߈tSPh#h `|_e[_]ÐUWVSUj)Ѝ4XPEurXP_X0щMQËXVS_0щȃڃJ9v:/uS蹇_SK|_Ee[^_]ÐUEM Q)‹XR ]ÐUWVSh;#UR{_uhgh=#hX#0ۋ}щQ}щʃREPR_}щʃd#Bfh#fBURP譄_щT hj#Pz_ u+hghl#h#GRhVRz_ 0щƄ t t C;t; u{{t{ tG?t? uG} tRU RV蔃_t; 0щƄ RVy_/WPO_R3_ Px_UR_jjP?y_P SRx_EPR}_ P轄_RIy_P=y_1[^_]ÐU WVS1h#}Wx_u!hgh#h#MQhSbx_ tF䐐}tQ)P}Q2_1ېQڋ}BPRh#Q0x_Wj/MQh#>P_(?)9} tW w_M 1[^_]ÐUWVSuU 0Ѓ]9~SRV4_3e[^_]ÐUS]1{tFjjR){_ t-jCPR˃_ %tS"]]ÐUUB< t<t< u ]ÐB ]ÐUWVSU}EtR1ۋMA(pRT tt u ] \EMA(M9H1PD2< <t< w] \2tKL2CEt Ct {t;t Q(C{ CP] \2tKL2CEt fCt#f{t;t QfCf{CPs] \2t KL2KMt Ct#{t;t Q'Ct{tKQEMA(M9H@Ee[^_]ÐUVSu] jjjSVLt`tWt%=$uh#Wy_ $j|_t=$t$됐e[^]ÐUjU RUR.M]ÐUEPTTT]UEPTPTPTTT]ÐUWVS}u ]SVWI؍e[^_]ÐUVS]u VSe؍e[^]ÐUh$ jq_UWVS]u }tVWShJ$h `zr_#5#=#e[^_]ÐUUR$]UVS##W$#W$X$X$=#u #đUR. Ãu #и|uiS調SB}&jhY$hq$u%h}$Rr_t 1e[^]ÐUS]##$#$$$SR-]]ÐUWVS}u ]##$#$$$SVW( ujh$h$.t CPjh$h$#1e[^_]ÐUS] ##$#$$${Pt SPRiURSUR | #jh$h$#и]]ÐUEU R@TP<u1]Ðjh$h%]ÐUUR4]UjjU RURl]ÐUWVSE1##%#%%%u MMy,tQ,RMA,VU~NM]j8Zr_Ãu-URDhlh%h%#иfjMQSC US$K({,C0C4 }tUZ4}u]}TUMQ,1e[^_]ÐUWVSu} ##)%#)%*%*%##u~4mF48a\GF,x4thhh+%h=%)V:yu-jhF%h_%,#и uPyRVοà t###~,t*UV_u#иi\~4tF48Et @F8 F8#tv4Vhh%1e[^_]ÐUWVS}u ##q%#q%r%r%s=#FwH uPyRWqà t#i#URVWà u!#2##uW4tG48 VURVWu tttjhs%h%#Љ؍e[^_]ÐUWVS}u ]##%#%%% u SjWSVWà ؍e[^_]ÐUE]ÐUE]ÐUS]S@RC$PC@]]ÐUE@@]ÐUWSh `h_E PEPh `t_h%h `i_#0ۉ׈tR#Ph%h `h_=tzh%h `h_PTPh%h `h_=th%P=< `t(< `9B`|@`Rh%h `Ph_ De[_]ÐUWSh `g_E PEPh `s_h%h `h_0ۋ=#t3#P#Ph&h `g_#Ph$&h `g_=t3PTPh)&h `g_PhI&h `og_=thN&P=< `t(< `9B`|@`Rhg&h `"g_ e[_]ÐU##&#&&&]ÐUWVSE0}Ѓ]K9]s;/u9]t`hjHg_Eujh&h&CURc_uC/jh&h&9hjf_ƃujh&h' 0҉Pi_ǃu1hlh!'h+'#1SVh8'Wn_jWOb_t$jh>'hV'jWb_tjhc'hv'FjWa_tjh'h'&}t*URb_ujh'h'819]tC/e[^_]ÐUWVS}1ۋG(9X~91@D0PW,Rn_uCG(9X̸e[^_]ÐUWVS}G(p EM9HEP}D:<v|: uzMD < tB<tg< tLW] }\:C;] M\ C] }\:sEEMA(}9xVMyPt yPWVMAPEA(@ P} WMQg_ }G(H ME}9x1PD2<v |2 D2< tX<t"< tl] \2CP Q}W g_ C.] \2CP Q}Wf_ Clj}*] \2KQ;WMQf_ []E}G(M9H e[^_]ÐUWVSEMA(M9H~a1PD2<v|2 u7D2< t<t'< u] \2;t ShEMA(M9HMqPA(@ PVM Qe_ MA(p EM9H1PD:<v |: D:< th<t"< ] \:{CPuSRVPKe_ C;] \:f{tbCP8SRVPe_ CƃB] \:{t#KQKQVPd_ sEMA(M9He[^_]ÐU WVSUB(JPH MEU9PnEpMD<v | 1UD< tv<t < ] M\UBPD@8Ct3}KCE] M\UBPDf@f9Cft3}KupCEp] M\UBPD@9CuKt3}u9[]:MA(@qPUt} |D t EEUB(M9H1e[^_]ÐUURb_uh'h `r^_j]_]ÐUEPh^_]UVSu]CPU RV h_3e[^]ÐUVS]u{t;t RtSVPVU RP'b_ Ce[^]ÐUVS]uf{t;t RAtfsVVU RPa_ fCe[^]ÐUVS]u{t;t RtsVVU RPia_Ce[^]ÐUh4je_TThTje_uu]ÐUTRj{e_=Ttj@^_P*`_uRjQe_=ut j^_P`_]ÐUT]ÐUu]ÐUWVS}} M9U :M9U :MM Pƃu 1EU 9:|VUM9|0MUMU9u MMGECU9}܃EEUM 9}t"O>VVQ[_"V:[_je[^_]ÐUWVS}} MM PEMQMQM9M 91|dMM M1ҋM9~&MM MM9u@u9E}~M MMGEFM 91}t%OM9QËMQ>Z_MQ'Z_1e[^_]ÐUU @PRMQ)^_]ÐUWVS]u ;LV>PRQ]_63e[^_]ÐU WVSuEEE} 9|Y}<}9|F9tVA9| 9u9};E8EEEEE} 9}e[^_]ÐUWVSU} uRh']^_e'?u'PQRh':^_9|.wQ(~(Ph( ^_ C9}h(]_e[^_]ÐUVSuR ÃtVS`؍e[^]ÐUWVS}4V:\_ÃuWh(]_ VjSg\_؍e[^_]ÐUWVSuU 9|9VtFC9|9u9}1fHPgE9}MV:9@9|C9| }9:C9}6N}7Ee[^_]ÐUVSMu ]9|!A9u0B9}e[^]ÐU WVSMyQRh(P\_EEPMI QUR$RMQURRMQEtO}UUMq$19}%>tRNQSh([_C9|ރ}t$h([_e[^_]ÐU4WVS}EE} .WhE} }EPO QO$QMQOQWẼ3}u_$u_$u19M 9K|u M؋C+E = v"E E܋E 0K)MM EEKMjEPMЍPOQWVEB9wMMЃ}u }W}unOM؋GE GM MEEEEW t-!WFSW6CER"EEEEEPMQWuEE؍e[^_]ÐUVS]RQ_{$t S$RS_SS_e[^]ÐUEU uSt:u* *Q *Qh `S_]Ð *QR ,*Qh `gS_]Ðxu=< `tRX_]Ðt:u@)P뇐@)P뚐UDWVS}] EPSW 9_uGM}~EPSW}u}t*SWuEPSW p]ȋMM̃hW@GCWtOQW&G$G$@jO$QjOQWWWZEPOQW E9Ev2jEPMQOQWrEPO QO$QVOQWEBu_$Eă_$E19}]u;uGjEPMQOQWWW1EB9|}uuNMɉMԋ_؃ȉGER"MMEEEEPSWZ tfSOQWw* tSjuVMQSW&t:OMȋMMjVMQSWt_WWWe[^_]ÐUWVSu] }u FJjSRS_ 9u.jWR V_tӃu!?R"u1Fe[^_]ÐUVS]=*u{u 11jjSRR(u*e[^]ÐUE=*tjPRP(*]ÐUSj(R_ÃhR_C$C MQE PMQS_‰ |kjCPRT_ u)CR"CCCSu/{R"u&CC CSNN_1]]ÐUVSu] jSRR_ 9ujURRZ_tF1e[^]ÐUWVS}]uEEPU RW tq9E~E9E}u)ޅ~/jU \SRuQ_ 9tG-VUR?WS_U92u E e[^_]ÐUPWVSu0EEPU RV UȉUtE}̃tÀ}tEPURV tEPURV tj}tỦUtUȉUEEEPU RVT t0tEPWV= t}tEPURV!u1e[^_]UWVS}uEPM QW t9u| E9E}Gt}~*jUM \SRO_ 9tGVMQRWX_ 9uE9E}EEPM QWYt1e[^_]US]jjRYO_ ujCPSW_t1]]ÐUWVS}W& E?tRH_}E@t W@RJ_w8t^ VRJ_VJ_ރuWJ_Ee[^_]ÐUWVS}uG 9vG  GWVVU RW!uW]W$JUG@ЉEPWE ÃuW&SREPEPWRW(RVU RuWduG W>GU9W,upCx ug@C@SW uWzG$W u WQWJ!Cx U9W,tx xjW ƃuWtVRSRURSVCSWD tVW5 uW GW 1CUptPRWu ÃuWV CpSW uW. tKVW Ãu W xCUSWj uW SURW t-MG@UDEG@ЉEPW ÃWg e[^_]UWVS]} uC 9vC CS VWSr}S$C@TRS teHKC@PCPMQKQK(QVWuS 17tKS C S e[^_]UWVS1UB@J,UB@PRtǃt0MAD9u2ADADPQ@RL_MA@u_{uGOUJ} uG@ BUBMA1X} t{ uFUB@[:FMI@CGP)‹C e[^_]ÐU,WVS] }G 9EvG}MA}W MQSWTuW}O$IMG@ȉEjWEu W`}}MA A Q )Ћ}GE܋MQS}WH_ MM}GMQWxƃ~WEPEPMIQ}(WMQ}WuMA ^{}u}GVCFP)‹[ ‹EM V}W-tMQWu}W%MAQ-Fx @UM9Q jQQÃ{WNQ}WEPMQ}WgNKFV}W} t!SWntMQW\u}WfMAQm}W'EjWÃjWEԃEPMQ}ԋWKQ~WMA A P}WEPMQ}W>MԋA}8QF@BSFFE؋CMH}{}ԉOF(VMQZ>S}WD(MQW.}t<}WMQƃF}xVMQ}}}M9y,QEԃjMQ;ƃj}W#ÃvF@F@ F@FMH{WNQjEP}WMQF}ԉ{SMQ$ }WMQ V}WMԉO,G$GWGW>1M}G@MDEG@ȉEPWƃM}9Ot5}MA A Q )Ћ}GEVMA A Q )Ћ}GEOM!t V}W}tMQ}WMQ`e[^_]ÐUS]{tjjRC_ ujCPRK_t C1]]ÐUVSu^8tH;u;{t5jSRRB_ 9CuV RSRR_K_ 9F t [ u1e[^]ÐUSMU zu9Q8} 9QW?_ 9Cű~ W{W>WH_ 9F uSV]1e[^_]ÐUVS]u VSƒt5BK0B@RS)ts0CSDe[^]ÐUVS]{0us4S S4#S0RSfts0@C0CSte[^]ÐUEjjjjP]ÐUS]SjjS{]]U(WVSEEEEEEE;E1jH>_Ã5CCU u"F$P0zJMEJMEzJMlJMYJMLJM<JM܃JM#JMu JKrMQMQW=>_ SjCP QL?_ƃMQ<_ǃMKMK MK(C$MK,C0ɉK4CSluG GGGjMQ Qh<_ 9EuMQW Q E_ 9Et1Wc8_M9KC$CDP)<_C@C81E}tMQMQSv }uaEXj;_Eto{8uC8MqAA K Q;_MAt9tN uM}uMK1Y]9]@u} 9G u'w]3(}}e[^_]ÐUWVSUEJ A}O M JO JOJOz}]BЍHM)Ƌ}GH)MR E ȉEEE}M9y M9Mu`}uZ1ҋ} 9}}M ECB9U }u M } }M OE} }M9M9M}u*1ҋM9~FM ECB931M ECB+F9|EM}}}}E}EM}9O e[^_]ÐUWVSEE} W J}W } }} W}W} W}W}] } GPU)EU9W }9}u8u19>~ CA91ɋ+F9}CA9|M_}u*1ɋU9~G}CG}A931}CG}A+F9|E}U 9z U}U 9z uztz)U z+}UzU BЍx})ƋUBЍx})ËU R } ؉EE}U 9z ~wU9Uu}}SU B H9Eu$zt}9z u9Uz#+U}}EU} 9W e[^_]ÐUWVSuM }y u]1Y]AȍP)‰Ѕu+\DE]99AȍP)‹I Ћ4]3?W]S]SA2_1e[^_]ÐU(WVSEEEE}}] MAȍP)‹y ‰UM A}GP)EEG 1M9Mu8}u219U ~M ECB9U } }Eo}u*1ҋM9~M ECB9>}61M ECB+F9|+FEE} utM؋}D9EseM y}Gy M؉M}t} O UM)щO}(t,},BM(M܉ƒtK }܈O}Ju]$E؋MA @9E}u}؋M +y M$y E؋M +A H}$G EM +A+E}$GAȍP)‰U܋MAȍP)Ƌ}  ]EEEA -M9Mux}urE}9}u&Myt}} OE}?;}t E@9Eu } M M܋} y9M MX}9}u(Myt}} OE#}?;E}>M܉9EEM9Mu@}$GP)‹O ÉU܋E} G)EMyuGE؋}G @9EMyM$ye[^_]ÐUWVS]u S{u"uPSC{WS,uCKu QC9B ~{uA@AC{tBSRSuC두A@ HCu{uA@ CCUUS!XURURURURIQSR?tSC1Se[^_]ÐUWVS]}1C@K,C@PStM@xu 1wPS@RC@PKQK(QWM QuC 0CD9u CDCDPK@Qp._C@tFhe[^_]ÐUVSuF$V V,F0V ҉V4FVtkjVÃtZV,SC@ C@C@C@V4RR'_tSV e[^]ÐUVSu]=1t 1jU RV+_ uh1V,_j#_}ffUfEEUUEPtPV&_ u+=< `#uh1+_j%_t j/_봃%e[^]ÐUE=1t1]ÐfEfEtU UEEEPjURc%_]ÐUWVS}1ۋU9U u 1[EPW RW$RSU RWƃt/URW$RSURWtt]u1e[^_]ÐUVS]uC 9vC\S6jjR2)_uVU RR1_ 9tS(CS1e[^]ÐUS]C 9EsC_Sjj Q(_u C PM Q Q*_S 9tSCS1]]ÐUWS=2u\h2<%_Ãt?0ЅuP,(_2SP-_222e[_]ÐUS]U Rj/nPh2S,_]]ÐUSTu1=Tt@] options are: -v list db/tables created -b reinstall basic types (bibts) -u name DB (default: "class.edb") Built-in basic typesbibta void objectbibtNONEa C-style addressbibtPOINTERANYbit stringbibtBITANYbooleanbibtBOOLEANBOOLEAN_REFcharacterbibtCHARACTERCHARACTER_REFinteger representationbibtINTEGERINTEGER_REFsingle-precision float representationbibtREALREAL_REFdouble-precision float representationbibtDOUBLEDOUBLE_REFbooleanbibtBOOL_REFBOOLEAN_REFANYBOOLEAN_REFBOOLEANcharacterbibtCHAR_REFCHARACTER_REFANYCHARACTER_REFCHARACTERinteger representationbibtINT_REFINTEGER_REFNUMERICINTEGER_REFINTEGERsingle-precision float representationbibtREAL_REFNUMERICREAL_REFREALdouble-precision float representationbibtDBL_REFDOUBLE_REFNUMERICDOUBLE_REFDOUBLEbase set of compare operationsbibtCOMPARABCOMPARABLEBOOLEANInfix "="*CurrentotherInfix "="BOOLEANInfix "/="*CurrentotherInfix "/="Return valueitemASCII representationSTRINGoutvoidoutPrint ASCII representationvoidprintvoidprintBuilt in copy_CopyBuilt in clone_CloneRedefinable is_equalBOOLEANis_equalvoidis_equalRedefinable equalBOOLEANequalvoidequalRedefinable copyvoidcopyvoidcopyRedefinable cloneclonevoidcloneRedefinable deep equalBOOLEANdeep_equalvoiddeep_equalRedefinable deep copyvoiddeep_copyvoiddeep_copyRedefinable deep clone%1deep_clonevoiddeep_cloneCHARACTERBOOLEAN*CurrentPrefix "+"*CurrentPrefix "-"*CurrentInfix "+"*CurrentInfix "-"*CurrentInfix "*"*CurrentInfix "/"*CurrentInfix "^"INTEGER*CurrentInfix "\\"REALInfix "//"BOOLEANBOOLEANInfix "and"BOOLEANInfix "and then"BOOLEANInfix "implies"BOOLEANPrefix "not"BOOLEANInfix "or"BOOLEANInfix "or else"BOOLEANInfix "xor"BOOLEANotherInfix "and"BOOLEANotherInfix "and then"BOOLEANotherInfix "implies"BOOLEANotherInfix "or"BOOLEANotherInfix "or else"BOOLEANotherInfix "xor"BOOLEANInfix "="BOOLEANInfix "/="BOOLEANInfix "<"BOOLEANInfix "<="BOOLEANInfix ">"BOOLEANInfix ">="otherInfix "="*CurrentotherInfix "/="*CurrentotherInfix "<"*CurrentotherInfix "<="*CurrentotherInfix ">"*CurrentotherInfix ">="p1_Copy*Currentp1is_equalANYp1equal%1p2equalANYp1deep_equal%1p2deep_equal*Currentp1copy*Currentp1deep_copy%s for non-expanded basic typecdbchan == -1classlib.c%s:%u: failed assertion `%s' %s%cinfo%s: Not an Eon/Eiffel database. Can't open database `%s'classesFailed to open `Classes' table clustersFailed to open `Clusters' table featuresFailed to open `Features' table parametersFailed to open `Parameters' table suppliersFailed to open `Suppliers' table ancestorsFailed to open `Ancestors' table genericsFailed to open `Generics' table visibilityFailed to open `Visibility' table assertionsFailed to open `Assertions' table cdbchan > -1classlib.c%s:%u: failed assertion `%s' ..........********clusterclustercluster_idcluster_idClass: %s Unable to insert cluster "%s" for class "%s" EDclass_idFailed to delete class entries (error %d) cluster_idclass_nameclass_idclass_idclass_name %s REIversionclass_idclass_idfeaturecodeclass_idfeaturecodefeature_classclass_idfeatureFailed to delete feature entries (error %d) feature_classcodeclass_idfeatureclass_iddas_delete ( Features) failed featureclass_idclientfeatureclass_idclass_iddas_delete ( Visibility) failed Failed to delete visibility entries (error %d) cdb_supplier_insert: class #%d could not be found class_idFailed to delete supplier entries (error %d) supprec->class_id > 0classlib.c%s:%u: failed assertion `%s' supprec->supplier != (char*)0classlib.c%s:%u: failed assertion `%s' strlen ( supprec->supplier) > 0classlib.c%s:%u: failed assertion `%s' class_idsupplierclass_iddas_delete ( Suppliers) failed class_idclass_idgeneric_paramclass_idgeneric_paramFailed to delete generic entries (error %d) class_iddas_delete ( Generics) failed cdb_parameter_insert: class #%d could not be found featureclass_idnamefeatureclass_idnamefeatureclass_idclass_iddas_delete ( Parameters) failed Failed to delete parameter entries (error %d) featuretypeclass_idcdb_assertion_insert: class #%d could not be found typefeatureclass_idFailed to delete assertion entries (error %d) class_iddas_delete ( Assertions) failed cannot determine ancestry of unknown class "%d" class_idclass_idancestorFailed to delete ancestor entries (error %d) class_iddas_delete ( Ancestors) failed code == 'R' || code == 'F'classlib.c%s:%u: failed assertion `%s' code == 'U' || code == 'C' || code == 'A'classlib.c%s:%u: failed assertion `%s'  DecNovOctSepAugJulJunMayAprMarFebJanLHD@<84SatFriThuWedTueMonSun%02d:%02d:%02d %s %2d 19%2d%02d:%02d:%02d %s %s %2d 19%2d%s %2d %02d:%02d*** Memory allocation failure in `set_varfield1' (%d bytes) Showing keys for table "%s": Currrent key list empty Field = "%s" Direction = ?? Type = Unique Non-unique (end / none) Unknown (%d) ANDOR Conjunction = %s Value = (0x%x) %d %f "%s" Unknown (%d) (empty) ----- *** Memory allocation failure in `set_varfield2' (%d bytes) in %s, table = "%s" %d.%d.%d.%d%d.%d.%d.%d000000*DAT*%s: (%d) %s Too many databasesdi_open_dbNo memory for db namedi_open_db%s%c%sdatabases is closeddi_open_tableNo memory for table structuredi_open_tablecould not look-up file namedi_open_tablecould not open tabledi_open_tableunable to look-up index-file namedi_open_tableunable to bt_open/RO index-filedi_open_tabledatabases is closeddi_open_tableerror finding key in index-filedi_match_startunable allocate space for index-setdi_retrieve_setunable to read header in ib-clusterdi_match_startselect * from %s where %s = "%s" (unique) where %s = "%s" (non-unique) Unimplemented key typeKeyAddressUnimplemented key typeKeyAddressUnimplemented key typeKeyEmpty%u%d%d%ld%fUnimplemented key typeKeyDataWarning: key not in indexdi_find_uniquelocked record encountereddi_retrieve_setunable to read header in ib-clusterdi_retrieve_setunable allocate space for index-setdi_retrieve_setunable to read exising INDEX in ib-clusterdi_retrieve_setunknown read-flagdi_read_reclocked record encountereddi_read_recerror in `store_read'di_read_recread record size mis-matchdi_read_reccould not read extensiondi_read_recordunknown direction flagdi_traversetable has no indexed fieldsdi_traverseunable to allocate space for index setdi_traverseunable to expand index setdi_traverseunable to expand index set (key != unique)di_traverseunable to expand index set(2)di_traverseNo record has been selecteddi_delete_recordAttempt to deleted unselected recorddi_delete_recordcould not free store recorddi_delete_recordNo record to deletedi_delete_dupserror in index filedi_delete_dupsindex entry missingdi_delete_dupsUnable to read index cluster headerdi_delete_dupscould not delete recorddi_delete_dupscould not free store recorddi_delete_dupsUnable to read index clusterdi_delete_dupsCouldn't find key in clusterdi_delete_dupsCouldn't re-allocate for new cluster. di_delete_dupsCouldn't free old cluster. di_delete_dupsCouldn't re-insert new cluster.di_delete_dupscould not delete recorddi_delete_uniqueNo record to deletedi_delete_dupscould not free store recorddi_write_recordcould not allocate store recorddi_write_recordcould not write to storedi_write_recordcould not write to storedi_write_record(key exists?) Unable to insert into index %s'%s'di_insert_uniqueNo record to deletedi_delete_dupserror in bt_find index-filedi_insert_dupscould not create new INDEX clusterdi_insert_dupsunable to read exising INDEX cluster headerdi_insert_dupscould not allocate temp set spacedi_insert_dupsunable to read exising INDEX clusterdi_insert_dupscould not write swapped INDEX clusterdi_insert_dupsCouldn't free old index. di_insert_dupsunable to re-allocate a larger INDEX clusterdi_insert_dupscould not insert re-allocated INDEX clusterdi_insert_dupsNo memory for 000000 namedi_newdir%s%c%scannot access (existing) database dirdi_newdircould not create database directorydi_newdirobject exists and is not a directorydi_newdircould not change perms on existing databasedi_newdircould not allocate new file-namedi_newindex%s!%s%s%c%scould not open/create index filedi_newindexa+could not open database 000000 filedi_newindex%s %s %s could not generate new data-file namedi_newtable%s%c%scould not store_open (create) new data-filedi_newtable%s|%d|%d %s|%d|%d|%d could not write to schema to storedi_newtablecould not write to schema size to storedi_newtablea+cannot access database directory filedi_newtable%s %s %s error creating index on tabledi_newtablestore label record baddi_getschemaunable to read schema record sizedi_getschemaunable to read schema recorddi_getschemaerror copying header from schemadi_getschema%[^|]|%d|%d error copying header from schemadi_getschema%[^|]|%d|%d|%d error scanning in field descriptiondi_getschemar%s!%s%X %*s %*s %X %06Xerror in DI routine "%s": %s rcould not open 000000 filedi_read_dir0.tmpwcould not open 0.tmp filedi_read_dirrcould not open 000000 filedi_read_dir%s %s %s %s%c%sLocked - waiting. ##A serious error occured while the database was being processed. %s: (%d) %s Failed to open databasedas_open_dbEON_NOLOCKTable does not existdas_openFailed to open tabledas_openFailed to close tabledas_openFailed to delete tabledas_delete_tableNo memorydas_makekeySingle field onlydas_seekFailed lookup field namedas_seekdas_seekError reading recorddas_read Error %d: %s Extra information: Error %d: %s Error from STORE routine Operation system message: %s. Error %d from `das' routine "%s": %s Error %d from DI routine "%s": %s Error from STORE routineOperation system message: %s. Failed to get current directory namedas_fullnameFailed to change to database directorydas_fullnameFailed to get database directory namedas_fullnameNo memorydas_fullname%s/%sDatabase does not existdas_fullnameNo read permissiondas_fullnameNo write permissiondas_fullnameCan't return to local directorydas_fullnameOut of memory. %s: set is void s%s: set has %d item%s: [|%s%d] unable to allocate space for %d set-items $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stalloc.c,v 1.1 89/10/24 10:09:12 mjr Rel $H(FREE LIST DUMP %x %d: SIZE %d ADDR %x NO FREE LIST $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stclose.c,v 1.1 89/10/24 10:09:13 mjr Rel $($Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/sterrs.c,v 1.1 89/10/24 10:09:14 mjr Rel $@))))))record too smallno such recordrecord I/O errorbad record headerno record errorcannot open *%s *%s: %s $*$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stfree.c,v 1.1 89/10/24 10:09:14 mjr Rel $0*$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stgethed.c,v 1.1 89/10/24 10:09:15 mjr Rel $*$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stopen.c,v 1.1 89/10/24 10:09:16 mjr Rel $*$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stputhed.c,v 1.1 89/10/24 10:09:17 mjr Rel $T+$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stread.c,v 1.1 89/10/24 10:09:17 mjr Rel $+$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stunlink.c,v 1.1 89/10/24 10:09:18 mjr Rel $,$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwrite.c,v 1.1 89/10/24 10:09:19 mjr Rel $t,$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stwsuper.c,v 1.1 89/10/24 10:09:19 mjr Rel $,$Header: /atreus/mjr/hacks/btree/btlib/RCS/btclose.c,v 1.1 89/10/24 10:08:55 mjr Rel $4-$Header: /atreus/mjr/hacks/btree/btlib/RCS/btdelete.c,v 1.1 89/10/24 10:08:56 mjr Rel $-$Header: /atreus/mjr/hacks/btree/btlib/RCS/btfind.c,v 1.1 89/10/24 10:08:57 mjr Rel $-$Header: /atreus/mjr/hacks/btree/btlib/RCS/btgoto.c,v 1.1 89/10/24 10:08:58 mjr Rel $H.$Header: /atreus/mjr/hacks/btree/btlib/RCS/btinsert.c,v 1.1 89/10/24 10:08:58 mjr Rel $.$Header: /atreus/mjr/hacks/btree/btlib/RCS/btio.c,v 1.1 89/10/24 10:08:59 mjr Rel $/$Header: /atreus/mjr/hacks/btree/btlib/RCS/btoopen.c,v 1.1 89/10/24 10:09:01 mjr Rel $X/$Header: /atreus/mjr/hacks/btree/btlib/RCS/btopen.c,v 1.1 89/10/24 10:09:00 mjr Rel $/$Header: /atreus/mjr/hacks/b+tree/btlib/RCS/btpage1.c,v 1.1 89/10/24 10:09:02 mjr Rel $0$Header: /atreus/mjr/hacks/btree/btlib/RCS/btpage2.c,v 1.1 89/10/24 10:09:05 mjr Rel $l0$Header: /atreus/mjr/hacks/btree/btlib/RCS/btravrs.c,v 1.1 89/10/24 10:09:06 mjr Rel $0$Header: /atreus/mjr/hacks/btree/btlib/RCS/btseek.c,v 1.1 89/10/24 10:09:06 mjr Rel $$1$Header: /atreus/mjr/hacks/btree/btlib/RCS/btzap.c,v 1.1 89/10/24 10:09:06 mjr Rel $1Seek errorRecord locking deadlock$Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stcopy.c,v 1.1 89/10/24 10:09:13 mjr Rel $2$Header: /atreus/mjr/hacks/btree/btlib/RCS/btlabel.c,v 1.1 89/10/24 10:08:59 mjr Rel $d2EON/usr/eon%s%c%s2hr``2?`@33Tp`eon3122/bin/xbr000777 000000 000001 00000000256 05710535136 013571 0ustar00rootother000000 000000 : xtermc -geometry 80x24+0+0 -fn '-misc-fixed-bold-r-*-*-14-*-*-*-*-*-*-*' -fb '-misc-fixed-bold-r-*-*-14-*-*-*-*-*-*-*' -title 'Eon/Eiffel browser' -tn xtermc -e ebrn $* & eon3122/bin/ebr000755 000000 000001 00000702004 05710535137 013543 0ustar00rootother000000 000000 dxNw-̀\ `D$4 `PxPhP`[̀US]jU RURURURURU ReujF`CCCCSS t]]ÐUS]RusC]]ÐUWVSu 1u>tj]C;tJ8u;t?EP#URUP]GFu 밐F랐EPURUP GU9z~3t"PCΐe[^_]ÐUE PEPEPEPEPE PEP ]ÐUWVS]}uU RURURVWU RS"s8jjjc4PjFPGPU RdC,8tPqS,ROrjjj%4PURjWU DPcC0tPqS0RrC<C4e[^_]ÐUWVSu `hShP>=hd`tj/PhS}~$F8-t}t j|`PSIh(d3Ph(j=(W_u#j=(W_t=WhS ` jhSh(7j_j5=(W0}>WhS ` jhSh(%7j_2 2 h(lW1Ph(0Wh$h[hh(0= E(JBDžjjjjPQRCjjWl h1WljjWl hGWljjWvl h^WljjWOl huWkljjW(l hWDljjWl hWlWnthDžTDžDžtDžDžDžDžxDžDžDž DžTDžDžDžDžDžDžDžDžDžt 0DžXTDž@Dž0Dž<DžDDžHDž4DžPDžTDžX dDžTDžDžDžDžDžDžDžDžDž lpVWhWNSlWVIdWlWSD$hWPpW =0Wy|DžTdWDžXS#DžXTSDžV#DžTVxDžhWk#DžTWLt#WDžDžt WDžDž1X[^_]ÐUh`JyRh`h`]ÐUh`h`hB{`hZq`]ÐUSh]S Sh(+}tUREE]]ÐUhh(*j`]ÐU=t#R|=(t#(RP,(X=hu;HjP(Rag (RRh(R#jkZ=`t `Rd`]ÐULX,0`ḥУ(]ÐUVSu] F(V F(TVtVe[^]ÐUWVS}] uVSW RJn FPSW,R9nNV_8CS0W)ne[^_]ÐU]ÐT , .@YY UVSu] F(VF(TVtV.e[^]Ð4 , .TT UVSu] F(VDF(TV(tVe[^]Ð , .PP UVSu] F(TVtV>e[^]ÐUEURU R@ P}l]ÐU]ÐU]Ð4 d @LUVS]u C(\8t#8Pǃ<ǃ8{,tC,PwC0C,C(TStSHe[^]Ð d UVSu] F(VdF(TVHtVe[^]ÐU]Ð , . UVSu] F(TVtVNe[^]Ð$d US]jU RURURURURU RVuj_CCCCS]]ÐUWVS]=th_hW_ƃ uhw_jX_VURjU Rp_VR_hW_ƃuh4_j_It+ Et/Ru(hhh6VYh!SkV_W_e[^_]UWVSu=u&yjE_y0׉yy9~;yyP_yRSP_ S_yHWVP_yHye[^_]ÐU=t P_]ÐUEU uRh_]Ð=$t,PRh_]ÐUS]hSSh]]ÐUh)]ÐUURd]UyhyURy]ÐUS]h+SffZfvh6hhqhz0f;t-SR/[ f;thf;u֋]]ÐUS]hSffWfvhhhhCf8t P2Cf8t hK[ S]]ÐUS]h Sf;t0ff fv#f;th(hhh"=t~2=t!=u$S hh]]ÐUS]hS~f;tPffAfvCff?fv6ff=fv)ff;fvhhhhbA;$0 0p`[SCf8t h[ SS[S h[Shchv[SM hcCS RhMSRh :[SR[ S]]ÐUS]h Sff8fv#f;thh-hjhs =t1=t@=t)1hhhv]]ÐUVSuhVGff3fff1fff/fvxf>tqf>tjff,fv]ff*fvPff(fvCff&fv6ff$fv)ff"fvhhTh%h.4$ 0@ 0@P`p]SvVS2hLhN hQhShUhXh[h_hhhkhs~hwnh^hNh>h.hhhx[^]ÐUS]hSffTfvhhhhf;t-SR/[ f;thhf;u֋]]ÐUS]hS>fflfv0ffjfv#f;thhhh<l$PppSj[h[S>h[SM[SWh]]]ÐUS]hS>fflfvhhh)h2P=t=uhPSR[ SE]]ÐUS]hZSffKfvhchhh=t1=u*hwCf8t PhW]]US]hS>ffHfvhhhhPf;t-SR/[ f;th:f;u֋]]ÐUS]h=SS%]]ÐUS]hESffffvhVh&hhf;uhQ[Sxh>]]ÐUSES@PS ]ÐUS]hSffQfvhh=hhf;t-SR/[ f;th8f;u֋]]ÐUS]h:SnffNfvhGhLhh=t=uSR[ SL]]ÐUVSuhVfffv=fffv0f>t)ff fvhhchnhw$  @ v v v v v v v v p p SvVS:~h&jhZv Vhh}_ vv hh[_hVZ[^]ÐUS]hSf;thhhh[f;u,SR[ f;uh<f;t֋]]ÐUS]hSfffv#f;th hhTh]f;td=t =t#搋SR[ f;t:h{SRg[ f;th~렐]]ÐUVSuhVGf>thhhh_SvVS[^]ÐUWVSu 1u>tj]C;tJ8u;t?EPURUP!GFu 밐F랐EPURUP GU9z~3t"PCΐe[^_]ÐUE 8 t 8 t8%uL8%uxNu?@@8 t8 t8%t,t#8%uxNu ^B  @B8uՁ vz^uJ ]ÐUWVSu}  dž dh$dcJu{O{ dž dh$dcJu{O{ dž dh$BdcJu{O{ dž dh$dcJu{O{dždh$dcJu{O{dždh$jdcJu{O{dž dh$"dcJu{O{dždh$ڿdcJu{O{ dž$dh$蒿dcJu{O{,dž0dh$JdcJu{O{dž dž dh$dcJu{O{ dž dh$貾dcJu{O{ dž dh$jdcJu{O{ dž dh$"dcJu{O{dž dždh$нdcJu{O{dždh$芽dcJu{O{dždž2h821Ju{O{dždždže[^_]ÐUS]tSR@P\ t P R@P\ t PR@Pw\ t PR@PN\ thPR@P%\]]ÐUWVS}Džu>Wh@P[ u@(x |t?hh `Z_@(@ PhKh `>_j|hnh `-_ M MjEPhRu\19~PC9^荷19~PC9^荷19~PC9^荷19~P]C9^荷 19(~P5C9^荷,194~P C9^jQ\7WjQy^ GPPG#PPxt1WtRPOtQW%PP*hPhPnptWlRh,PAGLP P,8WdWHX A LJ  ѽ9 +4PP_7PQ_PPMRPPQ:_PPRPPQ_PPRPLPQ_PP{RP PQh_ P P5R P,PQ"_,P,PR,Pz8888X X X X )tEѽ 1[^_]ÐU(WVSUDžB|Ph@PT u&h2\4G(x |tHhh `_G(@ Phh `_h|hh `_ EjEPh*QV 1ۋ9 ~'POC9^܍ 19 ~$PC9^܍ 19 ~$PC9^܍ 19 ~$PC9^j QLVB|Pj QX P PX 1?tk7q91w>/tN@97w>/u>/u?A@PFVSf_?WвPPh5 PtZW PoQRP PCGh; Ph< PJ| G. ǂ } |  ѽG9 +4 P PT_ PW6_ P PW P PW_ P PW P< PW_ P PeW P PWR_ P PW P    ) ѽB|PQ@P&O1[^_]ÐUWVSDžU uNPh=@PN} u"FPM @(x tEhfh `D_U @(@ Phh `%_hhh `_ } }jEPhM QVOuƴ 1ۋU9 ~PC9^u 1ۋ}9 ~PC9^u 1ۋM9 ~PQC9^u 1ۋU9 ~P!C9^j} WOhEPjM QQ #U!tωP PEP؋M PU@M ƄHEYuƄH}KYu9HUtEW PTMQURP؋} P/.؋M P؋U PMUǂ}ѽ;M9+4} P Pg_| PRU_ P P"WM P؋U PW_} P PQ Pd PR_ P PWM P؋U PW_} P PJQ P:  : :HH:HH)/ѽ1[^_]ÐUWVS}EuDPh@PYH ud@(x lt?hh `_@(@ Ph3h `~_jlhVh `m_ UUU UjEPhnjEPhvRI19~PC9^荷19~PC9^jRJ|kPjRSL u<#PUPBPSE몐U쉗LJ1e[^_]ÐU VS]UU1uDhPh@PF u.@(x 4t?hh `_@(@ Phh `_j4hh `_ U UUUUUfUUUjEPhjEPhjEPh!RG(jRH|VhPjRJ u(PREPoF 뿐ǃǃ1e[^]ÐU WVS}]EuAPh*@PD u5A@(x Lt?hWh `:_@(@ Phh `_jLhh ` _ U UUU]ffUUUjEPhjEPhjEPhR(F(19~PC9^jR.G|WPjRH u(PEEP`ÐULJ1e[^_]ÐUWVSu19 ~tj RV1ۃ 9 ~DU RPAu8/CG두1d[^_]ÐUS]jU RURURURURU R"$ujz_CCCCSS>2]]ÐUS]R1C]]ÐUWVSu 1u>tj]C;tJ8u;t?EPWURUPGFu 밐F랐EP URUPE GU9z~3t"PCΐe[^_]ÐUE PEPEPEPEPE PEP ]ÐUWVS]}uU RURURVWU RS-s8jjjPjFPGPU R<"C,8tP0S,R0jjjYPURjWU DP!C0tP/S0RD0C<C4e[^_]ÐUWVS]u (QjAC}t!0UЃPRV1_ h'MA@y@A0Pe[^_]ÐUWVSuMQM QN,Qv u.jMQ Qh(Oj譻_~019^8~P)C9_F@MQN0Q<F,th(V1ېF,9<PVF,9PPhtmh,VF,8*u,h/VF,8@PVx RVISF,9th5h8VEC$F,th:V} Ft} AuGh<VM9*u$h?VE@PVMQVN_jF,PVNjRMQM QN,Q{u#jMQ Qh(j_jF,PVjXMQM QN,Qu#jMQ Qh(4j蒸_hyF@N@F0PIF,tF1ۋF,9~TthVV,PVCĐhN@F0PL~t/19^~FPC9^NQFF FFV3F0PVYVe[^_]ÐUUE =t'= N= |G=Wu01]Ð ,QR, P]UWVS]u} {@ (QAJjjPRjQS{@WVsDe[^_]ÐU@VSuE FLPN@Quu-jh Qh( jk_V@tPRh]S_SjN Q] ~t019^~FPC9^NQFF FFF(jjPR@Ѓ ~<t119^4~F<PhC9^4N$ffBMJM JЉ]ÐU$9(wZ@$f fBMJЉ]ÐU$9(wB$f fBMJЉ]ÐU$9(wD$f fBMJM JMJ Љ]ÐU$9(wF$f fBMJЉ]ÐU$9(wJH$f fBMJЉ]ÐU$9(w J$ffBMJM JMJ Љ]ÐU$9(wL$ffBMJЉ]ÐU$9(wzN$ffBMJM JMJ Љ]ÐU$9(w*P$ffBMJM JЉ]ÐU$9(wR$ffBMJЉ]ÐU$9(wT$ffBMJЉ]ÐU$9(wZV$ffBMJM JЉ]ÐU$9(w X$ffBMJM JЉ]ÐU$9(wZ$ffBMJM JЉ]ÐU$9(wj\$ffBMJЉ]ÐU$9(w*^$ffBMJЉ]ÐU$9(w`$ffBMJM JMJ Љ]ÐU$9(wb$ffBMJM JMJ Љ]ÐU$9(wJd$ffBMJЉ]ÐU$9(w f$ffBMJЉ]ÐU$9(wh$ffBMJЉ]ÐU$9(wj$ffBMJM JЉ]ÐU$9(w:l$ffBMJЉ]ÐU$9(wn$f fBMJЉ]ÐU$9(wp$f!fBMJM JMJ Љ]ÐU$9(wjr$f"fBMJM JMJ Љ]ÐU$9(wt$f#fBMJM JMJ MJMJЉ]ÐU$9(wv$f$fBMJЉ]ÐU$9(wzx$f%fBMJЉ]ÐU$9(w:z$f&fBMJM JЉ]ÐU$9(w|$f'fBMJЉ]ÐU$9(w~$f(fBMJM JMJ MJMJMJM JЉ]U$9(wJ$f)fBMJЉ]ÐU$9(w $f*fBMJЉ]ÐU$9(w$f+fBMJM JЉ]ÐU$9(wz$f,fBMJЉ]ÐU$9(w:$f-fBMJЉ]ÐU$9(w$f.fBMJM JЉ]ÐU$9(w$f/fBMJЉ]ÐU$9(wj$f0fBMJЉ]ÐU$9(w*$f1fBMJM JMJ Љ]ÐU$9(w$f2fBMJЉ]ÐU$9(w$f3fBMJЉ]ÐU$9(wZ$f4fBMJM JMJ Љ]ÐU$9(w $f5fBMJM JMJ Љ]ÐU$9(w$f6fBMJЉ]ÐU$9(wz$f7fBMJЉ]ÐU$9(w:$f8fBMJM JMJ MJMJMJЉ]ÐU$9(w$f9fBMJЉ]ÐU$9(w$f:fBMJЉ]ÐU$9(wZ$f;fBMJM JMJ Љ]ÐU$9(w $f<fBMJM JMJ Љ]ÐU$9(w$f=fBMJЉ]ÐU$9(wz$f>fBMJЉ]ÐU$9(w:$f?fBMJM JMJ Љ]ÐU$9(w$f@fBMJM JMJ Љ]ÐU$9(w$fAfBMJЉ]ÐU$9(wZ$fBfBMJЉ]ÐU$9(w$fCfBMJM JMJ MJЉ]ÐU$9(w$fDfBMJM JЉ]ÐU$9(wz$fEfBMJM JMJ Љ]ÐU$9(w*$fFfBMJM JMJ Љ]ÐU$9(w$fGfBMJM JЉ]ÐU$9(w$fHfBMJM JMJ Љ]ÐU$9(w:$fIfBMJM JMJ Љ]ÐU$9(w$fJfBMJM JЉ]ÐU$9(w$fKfBMJЉ]ÐU$9(wZ$fLfBMJЉ]ÐU$9(w$fMfBMJM JMJ Љ]ÐU$9(w$fNfBMJM JMJ Љ]ÐU$9(wz$fOfBMJЉ]ÐU$9(w:$fPfBMJЉ]ÐU$9(w$fQfBMJЉ]ÐU$9(w$fRfBMJM JMJ Љ]ÐU$9(wj$fSfBMJЉ]ÐU$9(w*$fTfBMJЉ]ÐU$9(w$fUfBMJM JЉ]ÐU$9(w$fVfBMJЉ]ÐU$9(wZ$fWfBMJЉ]ÐU$9(w$fXfBMJM JMJ Љ]ÐU$9(w$fYfBMJЉ]ÐU$9(w$fZfBMJЉ]ÐU$9(wJ$f[fBMJЉ]ÐU$9(w $f\fBMJЉ]ÐU$9(w$f]fBMJM JЉ]ÐU$9(wz$f^fBMJM JЉ]ÐU$9(w*$f_fBMJM JMJ Љ]ÐU$9(w$f`fBMJЉ]ÐU$9(w$fafBMJM JMJ Љ]ÐU$9(wJ$fbfBMJЉ]ÐU$9(w $fcfBMJЉ]ÐU$9(w$fdfBMJM JЉ]ÐU$9(wz$fefBMJЉ]ÐU$9(w:$fffBMJЉ]ÐU$9(w$fgfBMJM JMJ Љ]ÐU$9(w$fhfBMJM JMJ Љ]ÐU$9(wZ$fifBMJЉ]ÐU$9(w$fjfBMJЉ]ÐU$9(w$fkfBMJM JЉ]ÐU$9(w$flfBMJЉ]ÐU$9(wJ$fmfBMJЉ]ÐU$9(w  $fnfBMJM JMJ Љ]ÐU$9(w $fofBMJЉ]ÐU$9(wz$fpfBMJЉ]ÐU$9(w:$fqfBMJM JMJ Љ]ÐU$9(w$frfBMJM JMJ Љ]ÐU$9(w$fsfBMJЉ]ÐU$9(wZ$ftfBMJЉ]ÐU$9(w$fufBMJM JMJ Љ]ÐU$9(w$fvfBMJЉ]ÐU$9(w$fwfBMJЉ]ÐU$9(wJ$fxfBMJM JMJ Љ]ÐU$9(w $fyfBMJЉ]ÐU$9(w"$fzfBMJЉ]ÐU$9(wz$$f{fBMJM JMJ Љ]ÐU$9(w*&$f|fBMJЉ]ÐU$9(w($f}fBMJM JMJ Љ]ÐU$9(w*$f~fBMJM JЉ]ÐU$9(wJ,$ffBMJM JЉ]ÐU$9(w.$ffBMJЉ]ÐU$9(w0$ffBMJЉ]ÐU$9(wz2$ffBMJM JMJ MJЉ]ÐU$9(w*4$ffBMJM JЉ]ÐU$9(w6$ffBMJM JMJ Љ]ÐU$9(w8$ffBMJM JMJ Љ]ÐU$9(w::$ffBMJM JMJ Љ]ÐU$9(w<$ffBMJM JMJ MJЉ]ÐU$9(w>$ffBMJM JMJ MJMJЉ]ÐU$9(w:@$ffBMJM JЉ]ÐU$9(wB$ffBMJM JMJ Љ]ÐU$9(wD$ffBMJЉ]ÐU$9(wZF$ffBMJЉ]ÐU$9(wH$ffBMJЉ]ÐU$9(wJ$ffBMJM JMJ Љ]ÐU$9(wL$ffBMJЉ]ÐU$9(wJN$ffBMJЉ]ÐU$9(w P$ffBMJM JMJ Љ]ÐU$9(wR$ffBMJЉ]ÐU$9(wzT$ffBMJЉ]ÐU$9(w:V$ffBMJM JMJ Љ]ÐU$9(wX$ffBMJM JMJ Љ]ÐU$9(wZ$ffBMJM JЉ]ÐU$9(wJ\$ffBMJM JЉ]ÐU$9(w^$ffBMJM JЉ]ÐU$9(w`$ffBMJЉ]ÐU$9(wjb$ffBMJЉ]ÐU$9(w*d$ffBMJM JЉ]ÐU$9(wf$ffBMJЉ]ÐU$9(wh$ffBMJЉ]ÐU$9(wZj$ffBMJM JMJ Љ]ÐU$9(w l$ffBMJЉ]ÐU$9(wn$ffBMJM JЉ]ÐU$9(wzp$ffBMJM JЉ]ÐU$9(w*r$ffBMJЉ]ÐU$9(wt$ffBMJM JЉ]ÐU$9(wv$ffBMJM JЉ]ÐU$9(wJx$ffBMJЉ]ÐU$9(w z$ffBMJЉ]ÐU$9(w|$ffBMJM JMJ Љ]ÐU$9(wz~$ffBMJЉ]ÐU$9(w:$ffBMJЉ]ÐU$9(w$ffBMJM JMJ Љ]ÐU$9(w$ffBMJЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJM JMJ Љ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wZ$ffBMJM JMJ Љ]ÐU$9(w $ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJM JMJ Љ]ÐU$9(w:$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJM JЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJM JMJ Љ]ÐU$9(w$ffBMJЉ]ÐU$9(wZ$ffBMJM JЉ]ÐU$9(w $ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJM JЉ]ÐU$9(w:$ffBMJM JЉ]ÐU$9(w$ffBMJM JMJ Љ]ÐU$9(w$ffBMJM JMJ MJЉ]ÐU$9(wJ$ffBMJM JMJ Љ]ÐU$9(w$ffBMJM JЉ]ÐU$9(w$ffBMJM JЉ]ÐU$9(wZ$ffBMJM JЉ]ÐU$9(w $ffBMJM JЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wz$ffBMJЉ]ÐU$9(w:$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wz$ffBMJM JЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJM JMJ Љ]ÐU$9(w蚿$ffBMJM JMJ Љ]ÐU$9(wJ$ffBMJЉ]ÐU$9(w $ffBMJЉ]ÐU$9(wʾ$ffBMJM JЉ]ÐU$9(wz$ffBMJЉ]ÐU$9(w:$ffBMJЉ]ÐU$9(w$ffBMJM JMJ Љ]ÐUS$9(w詽$ffB]ZM JM]J ZЋ]]ÐU$9(wJ$ffBMJЉ]ÐU$9(w $ffBMJЉ]ÐU$9(wʼ$ffBMJЉ]ÐU$9(w芼 $ffBMJЉ]ÐU$9(wJ $ffBMJЉ]ÐU$9(w $ffBMJЉ]ÐU$9(wʻ$ffBMJЉ]ÐU$9(w芻$ffBMJЉ]ÐU$9(wJ$ffBMJM JЉ]ÐU$9(w$ffBMJM JЉ]ÐU$9(w誺$ffBMJЉ]ÐU$9(wj$ffBMJЉ]ÐU$9(w*$ffBMJЉ]ÐU$9(w$ffBMJЉ]ÐU$9(w誹 $ffBMJЉ]ÐUSf] $9(we"$ffBMJfZЋ]]ÐU$9(w$$ffBMJЉ]ÐU$9(wڸ&$ffBMJЉ]ÐU$9(w蚸($ffBMJM JЉ]ÐUS]0fCf{!H=$lllL lllllLllLlL<ll<<<llLLlll<llLLܳll<llll<ll<llLllLLllllLLllLLll<LL<LLlllLLlllLll<llLllll<<LlLll<llLLll<llLllLLllLllLllLlL<<ll<LLLܳ<LlllLllLllLL<<<ll<ll l<<l<<llLllLllLllLllLll<llLl<ll<<LL<<<<lllllllllllllllllllllllllllLL[0SRS RSRSRSRSRS RS$R S(R[,SRS RSRSRSR[SRwS RnSReSR\[YSRGS R>SR5[ 2[ SRS R[[SR[ ]]ÐUS]9ď|(H9u %J@9ď}ďď9DujhDhH0bďHď]]ÐU@RU RjURO_]ÐUSSEPfShN@R?O_]ÐUS]u4@P9Pwh''f{uY@P9PwhPJ_@Sf4jh4c'f{vY@P9PwhPuJ_@SDf4jh4jS|f;vI@P9PwhPJ_@jSb4@B9BwPRI_ BfCH=j&$ ,Ll ,̼ ,Ll̽ ,Ll̾ ,Ll̿ ,Ll ,Ll ,Ll<\|<\|\|<\|<\|<\|<\|<\|<\|<\|Ll ,Ll ,Ll,Ll ,Ll ,Ll ,Ll ,Ll ,\|<\|<\|<\|,Ll\|<\<\|[`CPCPhR!CPCPh[!CPCPhdCPCPhm @QI_KQK QKQKQ KQKQK QK$QK(Q[,~CPCPhv CPCPh CPCPh @QAH_hp[S\hph @QH_@P9P CPCPh; CPCPh CPCPh+CPCPhCPCPhCPCPhCPCPh{CPCPhCPCPhCPCPhCPCPhCPCPh;CPCPhCPCPh CPCPh{CPCPh[CPCPh$kCPCPh-KCPCPh6CPCPh?CPCPhHCPCPhQCPCPhZ{CPCPhc[CPCPhlkCPCPhuKCPCPh~+ CPCPhCPCPhCPCPhCPCPh{CPCPh @QD_KQK QKQKQ KQ[CPCPhCPCPhCPCPhCPCPhCPCPh{CPCPhCPCPh;CPCPhCPCPh+CPCPhCPCPhCPCPhCPCPh CPCPh)[CPCPh2;CPCPh; @QA_KQK QKQzKQq[ nCPCPhDCPCPhMCPCPhVCPCPh_CPCPhhKCPCPhq+CPCPhz;CPCPhCPCPhCPCPhCPCPh+CPCPhCPCPh{CPCPh[CPCPhkCPCPhCPCPhCPCPh @QQ?_hp[SShph CPCPhkCPCPhKCPCPh[CPCPh;CPCPh CPCPhCPCPhCPCPh(CPCPh1kCPCPh:KCPCPhCCPCPhL CPCPhUCPCPh^CPCPhgCPCPhpCPCPhykCPCPhKCPCPh CPCPhk CPCPhCPCPhCPCPhCPCPhCPCPhkCPCPh CPCPh+CPCPh CPCPhCPCPhCPCPhCPCPhCPCPh  CPCPhKCPCPh+CPCPh$;CPCPh-CPCPh6CPCPh?CPCPhHCPCPhQkCPCPhZKCPCPhc[CPCPhl CPCPhuCPCPh~ CPCPhCPCPhCPCPh CPCPhKCPCPh[ CPCPhk CPCPhK CPCPhCPCPhCPCPh+CPCPhCPCPh{ CPCPh[ CPCPh; CPCPhCPCPh @Qq7_KQCPCPh3 CPCPh<  @QA/_[CPCPhE kCPCPhN KCPCPhW +CPCPh`  CPCPhi CPCPhr  @Qq._hp[SBhph{ +CPCPh~ CPCPh kCPCPh KCPCPh +CPCPh  CPCPh CPCPh CPCPh CPCPh CPCPh kCPCPh KCPCPh +CPCPh  CPCPh CPCPh CPCPh!CPCPh!CPCPh!kCPCPh !KCPCPh)!+CPCPh2! CPCPh;!CPCPhD! @Qq+_KQ<[ 9CPCPhM!CPCPhV!{CPCPh_! @Q+_hp[SS?hphh!CPCPhk!CPCPht!CPCPh}! @Q*_jCPj.CPCPh! @QQ*_jCPjC PCPCPh!kCPCPh!KCPCPh!+CPCPh! CPCPh!CPCPh!CPCPh!CPCPh!CPCPh! @Q)_hp[Sc=hph!CPCPh! @Q(_hp[S#=hph!CPCPh!CPCPh!CPCPh"CPCPh "CPCPh"nCPCPh" @Q'_CP{CPCPh%"CPCPh." @Q'_iCPCPh7" @Q'_hp[S;hph@" @Q]'_@P9PwjPP#_@]]ÐUS] E@fLf=Lu ďSSf L]]ÐU@RU RjUR&_]ÐUWVSuShC"@R&_0ЃPS<f[^_]ÐUWVS]@B9BwR"_t@Pf@ f<==t-=tY=t"&jh88H]&jh8jh<<PPSf98tYh `hI"T%_Ѓ>jh<D<PLj <P賈<H=%$ ,Ll ,Ll ,Ll ,Ll\|<\|<<\|<\|<\|<\|<\|<\|<\|<\|<\|<\| ,Ll ,Ll ,Ll ,Ll ,Ll ,Ll ,Ll,Ll<\|<\|<\|<\<l ,Ll ,LlPPha"!PPhk" PPhu"[PPh"5@V _P PPP PP P$P(P,PPh"+ PPh" PPh" PPh"PPh"PPh" PPh"kPPh"KPPh"PPh" PPh"kPPh"PPh#PPh #PPh#;PPh#PPh)#PPh3# PPh=#PPhG#KPPhQ#+PPh[#PPhe#kPPho#KPPhy#PPh# PPh#PPh#KPPh#+PPh#+ PPh#kPPh#KPPh#PPh# PPh#5@V_P P PP PPPh#{PPh#[PPh# PPh$PPh$PPh$PPh#$PPh-$PPh7$PPhA$[PPhK$;PPhU$PPh_${PPhi$PPhs$PPh}$5@V__P PPP PPh$;PPh$PPh${PPh$[PPh$PPh$PPh$PPh$PPh$;PPh$PPh$ PPh$PPh$;PPh %PPh%KPPh%PPh'%PPh1%;PPh;%PPhE%PPhO%;PPhY%PPhc%{PPhm%[PPhw%;PPh%PPh%PPh%PPh%PPh%PPh%{PPh%PPh%;PPh%PPh%PPh%PPh% PPh%k PPh&PPh &[PPh&PPh!&PPh+&PPh5& PPh?&PPhI&PPhS&PPh]&PPhg&;PPhq&PPh{& PPh&PPh&PPh&PPh&{PPh&[PPh&PPh&PPh&PPh&PPh&;PPh&PPh&{PPh& PPh';PPh'PPh'{ PPh%'PPh/'; PPh9'k PPhC'K PPhM'[PPhW';PPha'+PPhk'PPhu'[ PPh'; PPh' PPh'PPh'5@V_P P}PrqPPh'PPh'k PPh'PPh'PPh'PPh' PPh'KPPh'+PPh' PPh( PPh ( PPh(+ PPh( PPh)(;PPh3(PPh=(PPhG( PPhQ( PPh[(PPhe( PPho( PPhy(5@V/ _jP PPh(+ PPh(PPh(PPh( PPh({PPh([PPh(k PPh(K PPh(PPh( PPh( PPh(KPPh( PPh) PPh)PPh)K PPh#)+ PPh-)PPh7) PPhA) PPhK)+PPhU) PPh_)k PPhi)PPhs)+ PPh}) PPh)kPPh)PPh){PPh)PPh)kPPh)PPh)PPh)PPh)5@V_P P  PPh)+PPh)^PPh)>PPh)PPh *5@V_bPPh*PPh*PPh'*PPh1*PPh;*{PPhE*{PPhO*;PPhY*PPhc*PPhm*PPhw*PPh*PPh*{PPh*[PPh*;PPh*PPh*PPh*PPh*PPh*PPh*{PPh*[PPh*;PPh*PPh+PPh +PPh+PPh!+PPh++5@V?_P PPh5+;PPh?+PPhI+PPhS+PPh]+PPhg+5@V__jPFj.PPhq+5@V/_jPj P PPh{++PPh+ PPh+PPh+PPh+PPh+PPh+kPPh+KPPh+KPPh++PPh+PPh+PPh+PPh+PPh,nPPh,5@V_PPPh,PPh%,5@V_PPPh/,5@V_5@Va0pЃPhpBe[^_]ÐUU@fLf=Lu ďEPf LE]ÐUS] H= $l l lll    ll, llL     lll llll\  ll lllll l ,llLlllllllllllll<lllll<\|llllll<\|ll ,LllSȏC SȏCȏRS ȏC ȏRSȏCȏRSȏCȏRSȏCȏRSȏCȏRxS ȏC ȏR\S$ȏC$ȏR@S(ȏC( ȏR!S,ȏC,SȏCSȏCSȏCSȏCwSȏCWSȏCȏRDS ȏC ȏR(SȏCȏR SȏCSȏCSȏCȏRS ȏC ȏRSȏCȏR|SȏCȏR`SȏCȏRDSȏCSȏCSȏCSȏCȏRS ȏC ȏRSȏCȏRSȏCȏRpSȏCGSȏCȏR4S ȏC ȏRSȏCSȏCSȏCSȏCSȏCwSȏCWSȏC7SȏCSȏCSȏCSȏCȏRS ȏC ȏRSȏCSȏCgSȏCȏRTS ȏC ȏR8SȏCSȏCȏRS ȏC ȏRSȏCȏRSȏCSȏCSȏCgSȏCGSȏC'SȏCSȏCSȏCSȏCSȏCSȏCgSȏCGSȏC'SȏCSȏCȏRS ȏC ȏRSȏCSȏCSȏCzSȏCZSȏC:SȏCȏR$S ȏC ȏRfK]]ÐUS]ScS]]ÐU]ÐU]ÐUE 9E%]ÐUWVSUE M]u8%%e[^_]ÐUEPEPEPEPURE@%PURURUR&]ÐUEU Љ]ÐUEU ЋUE]UEPEPEPEPURURURURURh<,h̏_̏]ÐUEPEPEPEPhH,URx_URURURURW]ÐUVSuE 9F|4}FF@PÃVRRS_FRe[^]ÐUWVSu}|dU9V|\0M 9ЃFF@PËURQS[_U REP_EPS_Qce[^_]ÐUWVS]M U9J|w|sM9J|kUJ+MM0EBPƋU RM QV_S] Ss_E UEPSA_ M QU2e[^_]ÐUMQJx8 t8 uHJy|tDBQ]ÐUWVS] M9t]CAPkƋ}?WV_0Ѓ)Ƀ  BKM Q }7e[^_]ÐUWVS]u 0ЃC@PVPJ_؍e[^_]ÐUS]E ~C@P؋]]ÐUE8tU RP_]Ð]ÐUUE :tPR_]Ð]ÐUS];tPC]]ÐUWVS]u 0Љǃ;t9{!;t R{GPVS'_e[^_]ÐUVS]u ;tF9C";t RoFC@Ps6VS_e[^]ÐUWVS]u;t R+0} Љǃ9~{GPWU RP_e[^_]ÐUWVSu} ]>t R^CPS?WPm_e[^_]ÐUWVS]0u ҋ3ЍDC@P^ƋM Q;WV_P_ Q*3e[^_]ÐUWVS]E E0uҋ3ЍDC@PƋMQ;WVH_P_ Q3e[^_]ÐUWVSuEPU RSY_ >t Ra0ЃF@PUSP_[^_]ÐUWVSu} ]>t R^CP Kue[^_]ÐUWVSuh]S0}ЃU B=vhZ,h `g_U RSURSUUV}tURCEEe[^_]UWVSu} h]SSGMA=~h~,h `_?WSURSIMUV}tMQEEe[^_]US]jU RURURURURU R>Juj_CCCCSSZX]]ÐUS]RWC]]ÐUWVSu 1u>tj]C;tJ8u;t?EPsURUPGFu 밐F랐EP'URUPa GU9z~3t"P0Cΐe[^_]ÐUEU P$Wtu1]Ð_]ÐUWVSUBz|}M9y~c]KUB QP_~"UB MMAU)yEUM9Qe[^_]ÐUS]SCRS9S~CL B9SK]]ÐUWVS}1'jVO QSGRO Q$SF9w~=9w9w~3jVO QR1ۃ 9_~j O QMQC9_F9w΋ WUe[^_]ÐUWVS}19w~2jVG PxR1ۃ 9_~j G PPC9_F9w΋ W)Ue[^_]ÐU WVSuE}jN QN QRjN QOVFRN QRN Q P V(WNQBPBjN QN QQEPN QiWà jN QN QQN QOVFRN QQV(WNQB PB$1$tE==4=RtY=S1҃~rFH9f>t NB~JFH9|=1ҋN+N MF9FFH9 ^KM9^} FBEF9FFH9|~NN~ tN 8FH9FFFH9F uF F(MQP(R@,ЉE^CMQ_tMQ_EE9^u19^FP_t"FPG_F9EtFH9u 1C9^u9^9F9}+FF ^z9^~fti>tN N9^u>F+F F9F~F F9^uЅVrrFe[^_]ÐU WVSu 1h,V_u'=< ` u Vh,cUB1E@dh@UBPhVN_ tE0щƄ VEPRC뫐R_EX؍[^_]ÐUWVSu} WJ|8u J񐐐BFPUF1ۃ9^~SF@P=VNQPFPk_FFNQFPC묐e[^_]ÐUWVS]u}jU RURWVURU R AC PNs{C CCUSe[^_]ÐUWVS]u}jjURWVURU R@C s{C CCUSe[^_]ÐUVSu~tH19^~FPpC9^VR^F~ tV RE?F e[^]ÐUVSu] F(&VtVe[^]ÐUEURU R@ PMS]ÐU]ÐU]Ðd&&&&US]jU RURURURURU R>?uj_CCCCS]]Ð'UWVSu 1u>tj]C;tJ8u;t?EPURUPGFu 밐F랐EPKURUP GU9z~3t"PTCΐe[^_]ÐUS]jU RURURURURU R=uj*_CCCCSSK]]ÐUS]RYKC]]ÐUE PEPEPEPEPE PEP ]ÐUWVS]}uU RURURVWU RSs8jjj7 PjFPGPU R<C,8tPJS,R#Kjjj PURjWU DP<C0tP}JS0RJC<C4e[^_]ÐU0WVSuF(1j]S}W]S}W] SVF((1DžEDž}Eh;Ju{O{] hD-} W_1҅u< `U식SEPE}t } Wtjjj PjEPEP] S=;F,tPI~,WIjjjZ Pj(jEHP] }DP:F0tPH^0S@IF<}t}WEEt#SѹDžDž} t} W諹E$E [^_]ÐUVSu~<t219^4~F<PdC9^4V VR>Ro?RDAV8Se[^]ÐUS]HjPR4> R)?R@8S]]ÐUVS]u HjPR= VR>R>S@e[^]ÐUS]HjPR= R>R^@C8tPS]]ÐUVSu R_Ãt6VG ؍e[^]ÐUWVS}] j=R:4tW4RjR< R=+CG49d-~ d-W4w4VjR< j RG;;t95~CPR$;Fސj R;R:?WL?e[^_]ÐUVS]u jjRE< j=R:j R:RRM<j R:R5:R<jRjjRBFPjR; jxR!<Vd-j=R9R<R9FPjR~; jvR;SF>e[^]ÐUUjjPjPRAUEtLL]ÐUS]C0:CCC8h:je_,j=SHCD jjj=PRjjWF-MDP)3> t>uFCu -}LQQ7}j-DPS6IQ-DP=4 -Q-DPWVAQ-DP6IQ-DP3$ -Q]SWjS-DPs -LQw'N}~*}Wa_-MDPO'& -}LQ-W6e[^_]ÐUU E8t38\u @#8~u@8@u 8?u@ B@8u]ÐUSE ]ڀ8t8~u x@tJt@8u))؋]]ÐUWVS} ]1;<^tR<\tlz<~ulC;@tx;?uCtmj W0PW 1W0PCt<PW2-Ct PW0FC;\e[^_]ÐUVSuEPM QSv_SQ2ffBPf@fBN[^]ÐUWVSu} N 1V1N 1U:t!MQWRn1 M QR1M QS_SWURQbǃt"URSL_F 1NSUR[^_]ÐUS]jU RURURURURU RJ%uj_CCCCS]]Ð@U@VSut.EPVI_tf}@u.hhjSV|e[^]ÐUhhj.RURQ]ÐUjhj0RUR$]Ujj.RU RUR]ÐU(WVS] 1DžDžDžPEP|P_Ƅ(t t4PSP_Ƅ( ƅ=0t=@.PhP `.Ph\ 0Pht 00ҍ|щ˃Et=.Et=x/щȃÀt0Љƃ9~Et#0=-Ѝp9~}t(Et @.Et 0`.EEP_ 9~EPI ÃJ)ơ9~ jjjSPVP"ǃu1mW/jjDžWJ-Et .Etx/PWP-Et#hW +|PW/-|PW-EtRjP@W, =< ` u.PW,< `P-Ph0WM-t&jP@Wk,PW,}tKEt@.NEt03`.EPhh jPW+PW] P HE$Dž}t|uEt=PP@PPWo+jttPSajPWE+j\h\WƃAPP@PPW+jhhhWƃ ށWu4Džu.tl9uDžPB;~u'{?u!C9uj EPW9Dž C;u΃]W[^_]ÐUSE] ڀ8t8~u x@tJt@8u8u))؋]]ÐUWVS}EE1E=0tD .Qh0$; u9u}u1E FC;u9u}u9E~E8}EJM)jjjQEPVMQLEP3+E ; t;uBjMQAMMQ( PGMQ'? t?uGCujE@PMQQ( .QMQ 0QMQ1&MQ3*H9}j MQ&Fސ1jh@PE@PMQ'jhMQr Ƌ. ;~u%{?uC9uj M QMQ C;uЅuMQ;e[^_]ÐU WVSu1E1E} u: 00P0=0;t%; u9~1E @C;u9~ǡ9~7 IG)} uEjjjGPEP0PEP0P(E ; t;uKjURBU0P.& PF0P$> t>uFCu0P(} j0P'HP0P%.R0P%j.R@PUR0Po%(.RURx} ~*U R_0P%0P0'e[^_]ÐUWVSHjjjjFj PMQEV-' =0uVtjjjV$1ۃ j|V #CE~M M 9 0~OE9~8<jMQV8$QV_$CEEM 9jMQV $jVVe[^_]ÐUWVS1Džt=}wHyh1}W觿_jjUR#h1W_|uVWUR#jjURS#h1h41hS1URV#p|RhSZ_ S}txxtjhz1S8_ u5EPp_Hx4t4t놐0PpSP藾_pF K|R8_x01d[^_]ÐUU1:t:\u B:~u@B:u]UUE 8t38\u @#8~u@8@u 8?u@ B@8u]ÐUE0]ÐUWVS}] 10RWa<^tJ<\tdr<~ulC;@tx;?uCtmj9W(PW0RWICt<PWU!-Ct PWVFC;d09e[^_]ÐUURj]ÐUU RUR]ÐUHWVSu] ESV路_Eu/u @/ h/Et~EtXEEhVW_ƒu!hh.P0R_hh.PRVg]ERth=< `u_j0PhVC_Eu,hh.P/PV`Ehh.P=< ` u//RVtKEEPVz_tfEf%f=@tfhh.P0>EPV:_tfEf%f=t&hh.PD0PVdE}sE tc0ЃPVW_h}1W_jWI_uhh.P0XWNUVE0ҋ}щ@=v4hh.Ph0PVщȃPKVWJ_h1W_jW臭_ƒuEURF_BE t<щȃPVW_h1W踸_Wº_EWAEe[^_]Ujh1UR ]ÐU WVS]u }EPEPS$ EPS!tKt'Ev }Wu]}WuD?U `Pt"%9u `ЉE:t9EtlB:t9Eu9EtV `9 `wjh `_ `h `艭_MQMQSCEe[^_]ÐUVS]u thS h1S,Sr t hSe[^]ÐUWVSu0E11=1t111+11%أ1$1$1 1=1t P1Ѓ1tE0}Ѓ91~U @91𣌗UE PURV EPVWu%EPURURU RURVEtE=\J=D===M#=J=Kt1=O5=Wu=1%1=1P1ЋE PURV{=u'=Z `9 `$=1u' = 9u  U =u" 1jPURU RV# ( E PURV1RV!= =1t2=u) 1jE1PURU RV o99U 9u41jE1PURU RV4RRURU RURVpURURU RV=tG `9 `wjh `Τ_ `h `=_THU=u R1111Ee[^_]ÐUWVSu }]9uL `9 `wjh `_ `h `m_ST@9𡌗D RPWPURW PWURe[^_]ÐUWVS}] uUMM9=tK9u> `9 `wjh `_  `h `}_9 LH9~𡌗9tM 9uj1PVS!PPVPWPVWe[^_]ÐUWVS}] u1t, `Xt%9u ` ؉Ã.M=uV=u]=1t1+19|A `9 `wjh `舡_  `h `_M9t^1t=uLVJu8S t+ 1QjMQMQVW]M=u1Su$ `9 `?N1t/tΡ9u=1u 909}09uI1j1PMQMQWEPMQWn SWtSVMQMQWp9~F9~-EPMQW 1.==11+1P QV 1+ 1 1҃ 91~00B91졔10MQMQW>VWgEPMQW#e[^_]ÐUWVS] u}EPWURE 9~ @9URPWPUREPWURe[^_]ÐUUBЃ vBӃw ]Ð1]ÐUU=1u"1]Ð1]ÐB: t:t< v <v: uB:u]UWVSuMIE Hljx 02HJ}) 0 Hye[^_]ÐUWVS}u]U RURW{ -> u 1RPW FC>t9ԍe[^_]ÐUWVSh1赡_Ãu$h1h `襠_j_3h 2MÃtjShK_ 0Ѓh2ÃtjSh_ 0Ѓ Qhj臬_j" u 1~CPWPU" CU~F~̍e[^_]ÐUjHPRRHR,h2t PYh2t P?Rhj謫_]UVS]S" QuCTSU1H9u 118t1951~KxTu0@Rt PjB@PjRyPoF9511e[^]ÐUWVSMMMMM MMM=1u11=1jXcfMfOfMfOfMfORMME %Et MIMMIM MMMMUU9|EE9| }|} }1M QMQPR!jjPyEPQ1$9u~5MQPQO1ۃ 9]~j QC9]F9ufM fO fEfE fEMffHfGfMfOfEfEfEffHfGfMfOfEfEfHfGfMfOfEfEfHfG E ffOGVG} uMM O fEfGLG$ 1OUfGPfGNGT1<1fDw@NyMt jMt jW`Mt jWMMt WLGPPQjQe[^_]ÐUWVS]u0PU D(VP_ } U $XixiiixiiiU fDS@LVSy U fDS@40ЃfSf)‰fCU fDS@CRtjCRt jS"jSS e[^_]ÐUWVS}fGRfMG PQ&GW )+EPGW)+EPjjW1f|w@tMDw@P~GW)+E1PQ9\( ;tPCQ;uF~VuGGLP?W耶e[^_]ÐUWVSuFR %EFPFPVCà teFS )PFS)P;W tP(HFEPj>W] t S>WF PFPVà tdF S )PFS)P;W tP(HjFEP>W t S6Vle[^_]ÐUWVS}GR %EW=1uG$ @PQGPGPWà teGS )PGS)P Q) tP(H%GEPVQ t'$؅}C$)É PQBFGU9'G PGPWà teG S )PGS)P Q9 tP(H%VGEPQ t'4؅}C$)É PQRFGE9+=1uG$ @!Be[^_]ÐUWVS} 1xRzTuCF9|FR tFFRt@FPFV)ЃPQk 1f~~j QCF9|FNPFPPVBQJ NQQ讪FRtj FRt jVBFRt VCFRt jV"je[^]ÐUS]CNPCPPSRu SCRtjCRt jSCRt jSCRt S{VuSRSݩ]]ÐUWVS}] 1Tt WRhj__RLu2=< `uRhj.__Rhj_;.;.; u W;u  ; ue[^_]ÐUWVS}MQM QWI =1uG$ @PQ詨5UJ $xyyy(y8yOy_yHyXyhyxyyhuģeUģ5>5.ģΐh5pPW9]~PWC9]VW=1uG$ @!Be[^_]ÐUWVS]M UCR tJIC )C)lj}| |C9|C9}RQ;Wfsfsfs fsf}f{f}f{ f}f{f}f{1 951~ZxTuA@Rtj @Rt jPR@Rt jP?@Rt P>F951j1e[^_]ÐUWVSE <9E ~E}f1}f~s19 1~]] E}zTu8;u3}GU9t(B 9E|B9E|B9B9EA9 1F}G9|E}G9Ene[^_]UWVS}] MMMMM=1uG$ @PQCMQSWPW7uF9u~PWF9uPWs9uMQVWYPW}tb=1uG$ @!B] j WC9]=1u4G$ @PQrMQVW PWTF9uSMQMQWģPW+uF9u~PWF9uPW=1uG$ @!Be[^_]ÐU塜 `9 `w jh `̂_ `h `5_]ÐUWVS];=1u=1uC  @PW<U9UuAu 9u^URVWPWF9u}6U9U u8]9]URVWEPWC9]}URU RWPW]C9]~PWC9]PWwu F9u~AURVWPWOURVW PW3F9u‹URURW|ģPW]C9]~PWC9]PW=1uge[^_]ÐUS|-+ģ+++h9eQM3$8HX````````````````````````````(```````````````````````````````؁8``ȁ``x hp~nģ^N4>$.891]]Uh$2s_hG2i_jjjjjh\2U_]ÐUh2C_jjjjjh2/_]ÐUSEU M]]]ÐUh2 j謀_UWVS]u }P8tVWSh:3h `._252=2e[^_]ÐUUR]UVS282G32G3|8H3t8H3=2u 2UR. Ãu 2и|uiSSB}&jhI3ha3u%hm3_t (8e[^]ÐUS]282x32x3|8y3t8y3S-]]ÐUWVS}u ]282z32z3|8{3t8{3SVW ujh|3h3.t CPjh3h321e[^_]ÐUS] 282323|83t83{Pt SPRiURSUR  | #jh3h32и]]ÐUEU R@TPPu1]Ðjh3h3]ÐUURO]UjjU RURU]ÐUWVSE1282424|84t84u MMy,tQ,RLMA,VU~NM]j8_Ãu-URLhlh4h 42иfjMQSSC US$K({,C0C4 }tUZ4}u]}TUMQ,1e[^_]ÐUWVSu} 282424|84t8422u~4mF48a\GF,x4thhh4h-4)V:u-jh64hO4,2и uPRV6à t222~,t*UV u2иi\~4tF48Et @F8 F82P8tv4VhX41e[^_]ÐUWVS}u 282a42a4|8b4t8b4s=2FwH uPRWà t2i2URVWc'à u!2222uW-4tG48 VURVW& tttjhc4hx42Љ؍e[^_]ÐUWVS}u ]282424|84t84 u SjWz,SVWp2à ؍e[^_]ÐUEP8]ÐUET8]ÐUS]S@RC$PBSC@]]ÐUE@@]ÐUWSh `~w_E PEPh `褃_h4h `w_20ۉ׈tR2Ph4h `w_=t8tzh4h `lw_t8PPh4h `Qw_=8th48P=< `t(< `9B`|@`Rh4h `w_ De[_]ÐUWSh `nv_E PEPh `蔂_h4h `v_0ۋ=2t32P2Ph4h `v_2Ph5h `kv_=t8t3|8PPh5h `8v_t8Ph95h `#v_=8th>58PW=< `t(< `9B`|@`RhW5h `u_ e[_]ÐU282v52v5|8w5t8w5]ÐUWVSE0}Ѓ]K9]s;/u9]t`hju_Eujhx5h5CURr_uC/jh5h59hju_ƃujh5h6 0҉Px_ǃu1hlh6h621SVh(6WS}_jWq_t$jh.6hF6jWp_tjhS6hf6FjWp_tjhs6h6&}t*URAq_ujh6h6819]tC/e[^_]ÐUWVS}1ۋG(9X~91@D0PW,R|_uCG(9X̸e[^_]ÐUWVS}G(p EM9HEP}D:<v|: uzMD < tB<tg< tLW] }\:C;] M\ C] }\:sEEMA(}9xVMyPt yPWVMAPEA(@ P} WMQJv_ }G(H ME}9x1PD2<v |2 D2< tX<t"< tl] \2CP Q}Wu_ C.] \2CP Q}Wu_ Clj}*] \2KQ;WMQau_ []E}G(M9H e[^_]ÐUWVSEMA(M9H~a1PD2<v|2 u7D2< t<t'< u] \2;t ShEMA(M9HMqPA(@ PVM Qt_ MA(p EM9H1PD:<v |: D:< th<t"< ] \:{CPuSRVPs_ C;] \:f{tbCP8SRVPs_ CƃB] \:{t#KQKQVPs_ sEMA(M9He[^_]ÐU WVSUB(JPH MEU9PnEpMD<v | 1UD< tv<t < ] M\UBPD@8Ct3}KCE] M\UBPDf@f9Cft3}KupCEp] M\UBPD@9CuKt3}u9[]:MA(@qPUt} |D t EEUB(M9H1e[^_]ÐUURLq_uh6h `&m_jgl_]ÐUEPm_]UVSu]CPU RVv_3e[^]ÐUVS]u{t;t RtSVPVU RPp_ Ce[^]ÐUVS]uf{t;t RAtfsVVU RP{p_ fCe[^]ÐUVS]u{t;t RtsVVU RPp_Ce[^]ÐUhjqt_hjVt_]ÐURj/t_=tjl_Pn_Rjt_=t jl_Pn_]ÐU]ÐU]ÐUWVS}} M9U :M9U :MM Pƃu 1EU 9:|VUM9|0MUMU9u MMGECU9}܃EEUM 9}t"O>VVj_"Vi_je[^_]ÐUWVS}} MM PEMQMQM9M 91|dMM M1ҋM9~&MM MM9u@u9E}~M MMGEFM 91}t%OM9QËMQh_MQh_1e[^_]ÐUU @PRMQl_]ÐUWVS]u ;LV>PRQl_63e[^_]ÐU WVSuEEE} 9|Y}<}9|F9tVA9| 9u9};E8EEEEE} 9}e[^_]ÐUWVSU} uRh6m_e6?u6PQRh6l_9|.wQ7~7Ph7l_ C9}h 7l_e[^_]ÐUVSuR ÃtVS`؍e[^]ÐUWVS}4Vj_ÃuWh 7Bl_ VjSk_؍e[^_]ÐUWVSuU 9|9VtFC9|9u9}1fHPgE9}MV:9@9|C9| }9:C9}6N}7Ee[^_]ÐUVSMu ]9|!A9u0B9}e[^]ÐUEU uSt:u* 8Q 8Qh `e_]Ð 8QR $8Qh `We_]Ðxu=< `tRj_]Ðt:u@7P뇐@7P뚐UVSu]=(8t 1jU RVh_ uh,8"j_ja_}ffUfEEUUEPtPVc_ u+=< `#uh78i_jc_t jUm_봃%e[^]ÐUE=(8t1]ÐfEfEtU UEEEPjUR/c_]ÐUWVS]u }P8tVWSh8h `c_|85t8=e[^_]ÐUE)]ÐUWVSE=8t*81DŽ=~11҃t:@~u9jh8h8E͐huV]]+]P9ǃ(0}ҋ=`8PTf_t'5`8Vj/uVh8PGk_E#hlh8h8tt1hnhn;h;~BlPÃWSUVSVWߋltttUz4t J4QlJWvMA4t]WUB8B4ehlh=h=Dhlh=h=|$hlh=h>\WL[^_]ÐUWVS]S8C49C@t9{@uhqh>h;>hqhL>hq>@PK$Qv*u>hqh>h>K$ 8 {@tK@QC$P&뫐1C(9x1@UT0|0uORWSgPC(@PSu{@YK@QC$P&&C@>|0uIRWSPC(@PSqu){@K@QC$P%C@GC(9x@{@tK@QC$P%C@1e[^_]ÐUWVSu~4tF48&jh>h>uM yu'0}ЉÃU Z M Q@EPSURM QK4Ãu1hoh>h>U R@ u+hoh>h ?M Qd@URF$P#uM Q7@}WjEPjURN$Q.-Ãu,hjh?hjQUR.} 0щ}щRËEPU RhDSD_ Pj/)RhDVD_j0щʃRSj h@jEPj}tMQjVjQ2ǃDS&ujhDhE>W!h ER:_ǃ u*hghEh3E/PURE Ph?EW:_W:_[^_]ÐUxWVS l8QE PMQ^ ujhIEhoEPj/ME)Ph{ESFC_MQj@S u5hghEhE18E @ 19p1ېM I|t_E P ׅ}$)tM A )ЉA M QD<v| u!؋M APOM QD E @M I LE @D M A F9qgM Q Ӆ}$)tE H )щH hP[AE @ PM IQE PhE]SA_Dž0҉ЃPSjIQP1‰0։10M 9q1ېE PL QDPLQTRhEP7A_0҉ЃPQPIQP‹0у,FuE 9pathkhEhEAjPjIQPƒt6hkhFh(F 8Ph4FME)P6_à u9hgh7Fh]F QhsFhFP l8QE PhiFS6_S5_1M 9q~S1ۋE P|t8MQ|QDPTRM QEPƒgFM 9qEE+EP 1|[^_]UWVSjdxjjP8:_jdxEP$Zu2hkhFhF xQ1uVjEPjSRuNjUUu*hjhFhFxP{fRtVEPtQjSE@$Pǃu?hjhFh G+ xQtPMI$ 81tp1ۀ8 tCp< tOvCPu4hkhGh;GxPtQuSpPV8_ D+0҉҃px P xQxPhHGVN=_ǃup x QEPr=_duQxz}qChkhUGhvGhjhGhG xQtPl1Rd RPdxBRd RPdxBEDžxx9JlEh11ۋp9 tCp< tOvCPSpQlP6_ D+l0҃p|PMQEPhQhGlP;_ǃh0҉dRdx`PdL2h0҉dRhP`ID1P xIED1 xIED1x|KD1 K|1tPUׅ}$)t E)ЉESD2<v|2 uCP? xRD2 xMBL0|Exx9J25xEF UӅ}$)t F )ЉF tQxT[^_]ÐUWVS}u]?t Rt919w~#1ېG|t DPdF9wWROWI1e[^_]ÐUSEtÐ؋[4t Pu1]]ÐU,WVSUhG)ЋP/_ƃu 1MQM QhG]S8_SÁ}ԐWhGV/_WhGV/_u9]uۃt#t9]uCVT6_uV._ShGh|i8_|e[^_]ÐUWVSUr 1E9 ~\1ېPUR8_u'PU Rf8_u x>?Eu U9 e[^_]ÐUSM19t1A9u%]]ÐUWSt80҉߈tS|8PhGh `,._e[_]ÐUWVSUj)Ѝ4PEurPe9_0щMQzËVSK7_0щȃڃJ9v:/uS9_S-_Ee[^_]ÐUEM Q)‹R ]ÐUWVShGUR,_uhghHhH0ۋ}щQ苿}щʃRkEPR56_}щʃ(HBf,HfBURP5_щT h.HP,_ u+hgh0HhJHGRhV+_ 0щƄ t t C;t; u{{t{ tG?t? uG} tRU RV4_t; 0щƄ RV/+_/WP4_R6_ P4*_URS6_jjP*_PR*_EPR`._ P 6_R*_P*_1[^_]ÐU WVS1hVH}W*_u!hghXHhsHMQhS)_ tF䐐}tQ谼)P[}Q~0_1ېQڋ}BPRhHQ|)_Wj/MQhH>PK2_(?)9} tWU(_M 1[^_]ÐUWVSuU 0Ѓ]9~SRV2_3e[^_]ÐUS]1{tFjjRu,_ t-jCPR5_ %t8S]]ÐUUB< t<t< u ]ÐB ]ÐUWVSU}EtR1ۋMA(pRT tt u ] \EMA(M9H1PD2< <t< w] \2tKL2CEt Ct {t;t QC{ CP] \2tKL2CEt fCt#f{t;t Q=fCf{CPs] \2t KL2KMt Ct#{t;t Q迸Ct{tKQYEMA(M9H@Ee[^_]ÐUVSu] jjjSVWt`T8tWT8t%=2uhH*_ 2j"._T8t=2t2됐e[^]ÐUjU RUR]ÐUEP]UEPPP]ÐU WVSMyQRhI)_EEPMI QUR$RMQURRMQEtO}UUMq$19}%>tRNQShIQ)_C9|ރ}t$h,I)_e[^_]ÐU4WVS}EE} .WE} }EPO QO$QMQOQW&Ẽ3}u_$u_$u19M 9K|u M؋C+E = v"E E܋E 0K)MM EEKMjEPMЍPOQW%VEB9wMMЃ}u }W}unOM؋GE GM MEEEEWdt-!WSWCER"EEEEEPMQWGuEE؍e[^_]ÐUVS]R(_{$t S$Rf!_S]!_e[^]ÐUDWVS}] EPSW 9_uGM}~EPSW}u}t*SWuEPSW p]ȋMM̃hWGCWtOQW&G$G$@jO$QjOQWWWZEPOQW E9Ev2jEPMQOQWrEPO QO$QVOQWEBu_$Eă_$E19}]u;uGjEPMQOQWWW1EB9|}uuNMɉMԋ_؃ȉGER"MMEEEEPSWZ tfSOQW7) tSjuVMQSW&t:OMȋMMjVMQSWt_WWWe[^_]ÐUWVSu] }u FJjSR!_ 9u.jWR+$_tӃu!?R"u1Fe[^_]ÐUVS]=\Ju{u 11jjSRRpu\Je[^]ÐUE=\JtjPRP\J]ÐUSj(!_Ãh!_C$C MQE PMQ!_‰ |kjCPR#_ u)CR"CCCSu/{R"u&CC CSn_1]]ÐUVSu] jSR. _ 9ujURR(_tF1e[^]ÐUWVS}]uEEPU RW tq9E~E9E}u)ޅ~/jU \SR_ 9tG-VUR?W!_U92u E e[^_]ÐUPWVSu0EEPU RV UȉUtE}̃tÀ}tEPURV tEPURV tj}tỦUtUȉUEEEPU RVT t0tEPWV= t}tEPURV!u1e[^_]UWVS}uEPM QW t9u| E9E}Gt}~*jUM \SR_ 9tGVMQRw&_ 9uE9E}EEPM QWYt1e[^_]US]jjRy_ ujCPS&_t1]]ÐUWVS}W& E?tR_}E@t W@R_w8t^ VR_V_ރuW_Ee[^_]ÐUWVS}uG 9vG  GWVVU RW!uW]W$JUG@ЉEPWE ÃuW&SREPEPWRW(RVU RuWduG W>GU9W,upCx ug@C@SW uWzG$W u WQWJ!Cx U9W,tx xjW ƃuWtVRSRURSVCSWD tVW5 uW GW 1CUptPRWu ÃuWV CpSW uW. tKVW Ãu W xCUSWj uW SURW t-MG@UDEG@ЉEPW ÃWg e[^_]UWVS]} uC 9vC CS VWSr}S$C@TRS teHKC@PCPMQKQK(QVWuS 17tKS C S e[^_]UWVS1UB@J,UB@PRtǃt0MAD9u2ADADPQ@R_MA@u_{uGOUJ} uG@ BUBMA1X} t{ uFUB@[:FMI@CGP)‹C e[^_]ÐU,WVS] }G 9EvG}MA}W MQSWTuW}O$IMG@ȉEjWEu W`}}MA A Q )Ћ}GE܋MQS}W_ MM}GMQWxƃ~WEPEPMIQ}(WMQ}WuMA ^{}u}GVCFP)‹[ ‹EM V}W-tMQWu}W%MAQ-Fx @UM9Q jQQÃ{WNQ}WEPMQ}WgNKFV}W} t!SWntMQW\u}WfMAQm}W'EjWÃjWEԃEPMQ}ԋWKQ~WMA A P}WEPMQ}W>MԋA}8QF@BSFFE؋CMH}{}ԉOF(VMQZ>S}WD(MQW.}t<}WMQƃF}xVMQ}}}M9y,QEԃjMQ;ƃj}W#ÃvF@F@ F@FMH{WNQjEP}WMQF}ԉ{SMQ$ }WMQ V}WMԉO,G$GWGW>1M}G@MDEG@ȉEPWƃM}9Ot5}MA A Q )Ћ}GEVMA A Q )Ћ}GEOM!t V}W}tMQ}WMQ`e[^_]ÐUS]{tjjR?_ ujCPR_t C1]]ÐUVSu^8tH;u;{t5jSRR_ 9CuV RSRR_ 9F t [ u1e[^]ÐUSMU zu9Q8} 9QW_ 9Cű~ W{W>W_ 9F uSV]1e[^_]ÐUVS]u VSƒt5BK0B@RS)ts0CSDe[^]ÐUVS]{0us4S S4#S0RSfts0@C0CSte[^]ÐUEjjjjP]ÐUS]SjjSϤ]]U(WVSEEEEEEE;E1jH _Ã5CCU u"F$0`pzJMEJMEzJMlJMYJMLJM<JM܃JM#JMu JKrMQMQW] _ SjCP Ql _ƃMQ _ǃMKMK MK(C$MK,C0ɉK4CSluG GGGjMQ Q _ 9EuMQW Q+_ 9Et1W_M9KC$CDPI _C@C81E}tMQMQS6 }uaEXj _Eto{8uC8MqAA K Q _MAt9tN uM}uMK1Y]9]@u} 9G u'w]3(}}e[^_]ÐUWVSUEJ A}O M JO JOJOz}]BЍHM)Ƌ}GH)MR E ȉEEE}M9y M9Mu`}uZ1ҋ} 9}}M ECB9U }u M } }M OE} }M9M9M}u*1ҋM9~FM ECB931M ECB+F9|EM}}}}E}EM}9O e[^_]ÐUWVSEE} W J}W } }} W}W} W}W}] } GPU)EU9W }9}u8u19>~ CA91ɋ+F9}CA9|M_}u*1ɋU9~G}CG}A931}CG}A+F9|E}U 9z U}U 9z uztz)U z+}UzU BЍx})ƋUBЍx})ËU R } ؉EE}U 9z ~wU9Uu}}SU B H9Eu$zt}9z u9Uz#+U}}EU} 9W e[^_]ÐUWVSuM }y u]1Y]AȍP)‰Ѕu+\DE]99AȍP)‹I Ћ4]3?W]S]Sa_1e[^_]ÐU(WVSEEEE}}] MAȍP)‹y ‰UM A}GP)EEG 1M9Mu8}u219U ~M ECB9U } }Eo}u*1ҋM9~M ECB9>}61M ECB+F9|+FEE} utM؋}D9EseM y}Gy M؉M}t} O UM)щO}(t,},BM(M܉ƒtK }܈O}Ju]$E؋MA @9E}u}؋M +y M$y E؋M +A H}$G EM +A+E}$GAȍP)‰U܋MAȍP)Ƌ}  ]EEEA -M9Mux}urE}9}u&Myt}} OE}?;}t E@9Eu } M M܋} y9M MX}9}u(Myt}} OE#}?;E}>M܉9EEM9Mu@}$GP)‹O ÉU܋E} G)EMyuGE؋}G @9EMyM$ye[^_]ÐUWVS]u S{u"uPSC{WS,uCKu QC9B ~{uA@AC{tBSRSuC두A@ HCu{uA@ CCUUS!XURURURURIQSR?tSC1Se[^_]ÐUWVS]}1C@K,C@PStM@xu 1wPS@RC@PKQK(QWM QuC 0CD9u CDCDPK@Q_C@tFhe[^_]ÐUVSuF$V V,F0V ҉V4FVtkjVÃtZV,SC@ C@C@C@V4RR_tSV e[^]ÐUWVS}1ۋU9U u 1[EPW RW$RSU RW%ƃt/URW$RSURWt]u1e[^_]ÐUVS]uC 9vC\SvjjR_uVU RR5_ 9tShCSO1e[^]ÐUS]C 9EsC_Sjj Q_u C PM Q QG_S 9tSCS1]]ÐU@EPUR_fEf ]ÐUh9RUR/]ÐUh;RUR]ÐUjUR^_]ÐUhUR_]ÐUURU RURH_]ÐUURU RUR_]ÐUUR_]UUR_]UEP_UU)Ѝ<]ÐU塤]ÐUS]M 1ҡ tB됐]]ÐUEE ]ÐU< `]ÐUURX_]UUR(_U]ÐUU1vvfvfvfvf@]ÐUfUf~ ff~ff~ff~ff~]ÐUWVSvREH#4xR>www R4RS S^4Se[^]ÐURS9~S4T9~R8T;9Ju6VE} P} 77u}7e[^_]ÐUVS]u URlSPe[^]ÐUWVSuf] Ãǃ9=T=TtIvRJ#xRU+ T)щ9r MQR$T HP}PTP TT Mf FBfKf)=T=Ee[^_]ÐUVSEM fpFAfJfe[^]ÐUVSEu fXFC8t1fIfe[^]ÐUWVS} ff=(SWKURS_4f@VSWURS_SV[^_]ÐUWVS=TEtlW_G)E9_vLUփShT_Sh `+h `j 7_tu%9_w?uURhTt_e[^_]ÐUTT]ÐUWVSf} ft>UffT R)fÍIf÷f]fEEfENuft5Duf9{uURRufCfufLuLu9HuujhHuhDu LuDuPUROf{EfENufSfLufENuLue[^_]ÐUE U9Hus]ÐPDuR]ÐUUDuЉ]ÐULu]ÐUVSuSE PqVS._[^]ÐUVSf95Lu|4ShNwZ_Sh `h `j _fFf95Lu}͍e[^]UVS1ShSw_1f]Nuft DufBf\fuPhWw_fENuft,h `j P_Sh `Duf\fuh `j $_fFf`LuPh[wr_e[^]ÐU1ҐfENufBf~fLujhjwf>U]ÐUWVS]0PSV_e[^_]ÐUUBu 1]Ð: t: uЉ]UU 8 t8 t]ÐUWU:t0D}]ÐUWS]0Ѓxڐ: t: uJHy|tDe[_]ÐUWS]0ЃU ) CJe[_]ÐUE€8t:/uBB:u]ÐUWU0Ѓ9v8.u H9w}]ÐUS];tN9t `t#9t `C;u]]ÐUS];tN9t  `t#9t `C;u]]ÐUEuhlwh `__P_]ÐUWVSu] 0P_uPS6V_e[^_]ÐUSURs_Ãu؋]]ÐUhw_jt_UE`U P1]ÐUh0Pjh@P_1]ÐUh Pjh@PS_1]ÐUEv]Ðt; tUtulh t^h(j Iht3h(jhth(jP?1]ÐUh@]Uh@ ]Ujh@P<_=t$ƀƀƀ1]ÐUSh0P_v4D ,1һw 9wtBv]]ÐUhh@P_1]ÐUhjh@P_1]Ð@B A$@@@UWVSu/EEuh\\E}>$tPMуSF>.uj>V}_uj$MjMyu؀>.u(F `PtBP$#E]F>*u EM ]Fhft]9E|QzhuK#}M#]E]Eu}WMуEE]Et>t F>1e[^_]ÐUh(jUR]ÐUƀǀƀh`<`0`4@Gh@Fh0Pjh@P_t 1]Ð]ÐUǀh`h(jPǀǀ_htrǀǀjjPjǀǀh(jhP?hǀǀR~9}ejSPS-ǀh(jhP h@~9|jjQPǀǀ]]ÐUWVSh8udhh(j8P }  }7=xV hMYzC9uxQ~@(D\ذ9BtBh(PXPB9Bw%PRJ_@P@k=h}GzH9_~ƃt!h(jQ VCPjjRh8dh(j8P@(D ذ9BtBh(PWPB9Bw%PRA_@P@h(jhdPD Kh9h(jP@(D ذ9BtBh(PVPB9Bw%PR菲_@P@9BtBh(PkVPB9Bw %PR$_@P @hCz9|+{UtǂEM h(jhdPhlh(j} WlPAP M1=x^=h}_zC9|W~@(D\ذ9BtBh(PUPB9Bw%PR辰_@P@k hMAzH9Y~ƃt!h(jW VCPjjh8dh(j8P9@(D ذ9BtBh(PSPB9Bw%PR豯_@P@h(jhdP Kh9h(jP@(D ذ9BtBh(PDSPB9Bw%PR_@P@9BtBh(PRPB9Bw %PR蔮_@P @hCz9|+{UtǂEM Oh(jhP4}7 =xc hMYzC9Q~@(D\ذ9BtBh(PQPB9Bw%PRs_@P@k=h}GzH9_~ƃt!h(jQ: VCPjjrh8dh(j8P@(D ذ9BtBh(PPPB9Bw%PRa_@P@h(jhdPd Kh9h(jP7@(D ذ9BtBh(POPB9Bw%PR诫_@P@9BtBh(POPB9Bw %PRD_@P @hCz9|+{UtǂEM } e[^_]ÐUS]h`tFh(jS`P+;P-h(jhP Kuߋ]]US]jURU RSY S1]]ÐUE9u@P]ÐUWVS} }MAa ߉EA=}MA,}f] hpt} WpP./P 0hthPM } uMAPPjj$j}G6W4)@PRW<1e[^_]UWVS}7GO(WUEM]9w+9 tMuG(+؉ 9Msփt6O,q9f hhDP( hhHP hhLPh hPPh!hTPh"hXP h#h\Ph$h`Ph%hdPrh&hhP\ h'hlPCh(hpP-h)htPh*hxP h+h|Ph,hPh-hPh.hP h/hPh0hPwh1hPah2hPK h3hP2h4hPh5hPh6hP h7hPh8hPh9hPh:hP h;hP|h<hPfh=hPPh>hP: h?hP!h@hP hAhPhBhP hChPhDhPhEhPhFhP hGhPkhjhXPUhkh\P?hhP) hKhPhIhPhhPh[hP hlh`PhmhdPhnhhPhohlPs hRhPZhphpPDhqhtP.hShP hrhxPhZh|PhshPhthP huhPhvhPhwhPxhxhPb hhPIhyhP3hzhPh{hP h|hPh}hPh~hPhhP hhPhhP}hhPghhPQ hhP8hPh P"hhP hhP hhPhhPhhPhhP hhPhhPlhhPVhhP@ hhP'hQhPhhPhhP hhPhhPhh PhhP hThPqhhP[hhPEhhP/ hhPP]ÐUWVSufU fU=$x=t^=[C8t {uC8uF>;Րj q_Ct&[hj Q_É߅uI$xfj 1_Åu.$xtG;S _u3CSFfC >ufUfS e[^_]UWVSL+H+@+D+++$+ +4-P|(+,~<_+:' #ho <>(v$^##0#h(th(j(RӤhE0ҋ҉Ӄ9]=hMоS9$pMAM4@4pE9]Ne[^_]UWVS]1C(4{thtP茤%C(|9v1e[^_]ÐUVSu1ې RVB_uhDTC$~ָe[^]ÐUVSu1ې RV_uhDXzC ~ָe[^]ÐUVSu1ېxRV袋_uhC~Ӹe[^]ÐUWVS]1S6C(4{thtPuC,fPC0f{f9v1e[^_]ÐUWVS]u }S hA~H9SAzH9~ fsf{ jC@PjS1e[^_]Got a segmentation violation signal, cleaning up and exiting U} uhh `t_j_UWVS]u EPV_PS! ^h3_D `u}< `u@ `< ` p0 hHǀǀ@ƀƀǀƀƀƀƀƀh,t,PvjjhBzPB~PFjjhBzPB~P H H @@11(x@=@tm(x{tI;} QjHP(x QjVFQjSPCЃ G(x(x8uEEEj]Sj譆_EEEjSj莆_=u6jVhBzPB~)Pu1e[^_]ÐUUu1]Á=(xhs$(xM H(x1]Ð]ÐUh`u]Ðh(jh`Phhftʡhfth,x1]ÐUSfMfU f]f~+9| f|9~f| 9ɀˆp‹]]ÐUVSfuf] fMfUhhf9~uhxqufhwcfdw]fdwWhxqufwEfw>fw7h(jPPPPhhPgP1e[^]ÐUh@o]U1h`tCft9ft/tt xuhXt\t]ÐU]ÐUVSu MfUf~ 9}-Špffpf%ff91e[^]U$WVS]ujUR|_1E U܉E})EURjjhCS螋_jMQ|_}+}E)E܉EU+UM)щMy~ ME@B}}EEt$}E)ǍUE}<>؍e[^_]ÐUE0x]TIOCGWINSZUEPhTMQ|_ }!h~_]ÐEUt҅t1]def_shell_mode() tcgetattr() failed:Uh Ph@P蕃_uh1[~_jt_S5t_1]]ÐUVSh]t_EhE1ې1ҡhƋ8t,M8 uM B5h<uC~e[^]Ð%d%02d%03d%2d%3dUWVS]u1Z U 1ɐr4XA~T|X; ;%t#5|| CЃ] $БP0pЖ@ p pPPp@|%|" =T~' TTE1Rh;C< C;d 2u2=T~ TTE1Rh>=T~' TTE1Rh5|Vly_ =|0щ΃5| C;d =T~ TTE1Rh>C;d=T~ TTE1Rh!5|Vx_=|0щ΃5| l=T~' TTE1ҡ||!=T~' T5Tu1R|Prx_=|0щ΃5|C<xC<x=T~ T5Tu1DC<(C=T5TuTC1TBC< v=T~' T5Tu1҃=T~% TTE1!=T~' TTE1҃=T~% T5Tu 1)щ=T~' T5Tu1҃=T~% TTE1@=T~' TTE1҃=T~% T5Tu 1ɉȉ֙=TTET=T~' T5Tu1҃=T~% TTE1ɉȉ֙F=T~' T5Tu1҃=T~% TTE1!=T~' TTE1҃=T~% T5Tu 1 k=T~' T5Tu1҃=T~% TTE11=T~' TTE1҃=T~% T5Tu 19=T~' T5Tu1҃=T~% TTE19Ѓ=T5TuT=T~' TTE1҃=T~% T5Tu 19x=T~' T5Tu1҅8=T~' T5Tu1҃=TTETX\=T~' T5Tu1҅C1Ҁ;;%u,C;?u B#;;u ~\J ;eutL;tVC;u?C1Ҁ;t<;%uC;?u B;;u~ J;tC;uӀ;t C;|Xe[^_]ÐUU RURURl]couldn't open terminfo file %s. The terminal you are using is not defined. UWVS]jSyk_$},Shȝh `x@t%TtVjTP5~%2 ޫϫë{jQA+ Ԫlpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_margin96&# ߭ܭ٭֭ӭЭͭʭǭĭYGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxb-*$! ݮ׮Ѯͮɮîbitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinvspinhbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols$}iWF4)ܰͰzjZK;+߯˯bit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_char_sizemax_micro_jumpmax_micro_addressdot_vert_spacingdot_horz_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumnss*p!mjg da^[XUROLIFC@=:741.+(YpYoBTYnYmYlYkYjYiYhYgYfYeYdYbYcYaNCpaCoMWNlwssglico841-)#  ۿֿҿο˿ſ~xsnid^[WSOKHC?<83.("  ܾ־о˾ž|xtplhd`\XTQMIDA=951+%!  ݽڽ׽ѽͽɽŽzupkfa\WRMHC>94/*%  ߼ڼռм̼ȼü~ytoje`[WRMHC>94/*%  ߻ڻջл˻ƻ{vqlgb]XSNJFA<83.(# ޺ۺغպҺϺɺúzuoie_ZVPKE?;60*$ ޹عӹιɹĹ{vqlgb\VPJE=71(! ߸ڸոи˸Ƹ¸srslsr1sl1UWkzUWkkUWkiOTnlOTmuOTmlOTmaOTkoOTbcscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoncxoffcrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtrm]H9,$ |rcRF6't`K?)}pfUI:,"{rkaWMF?6/"{rgVE3'teVG?40!zm^PH?5-" xoaUI=2) uh^TG9.$ zrjbZRJB:2*" zrjbZRJB:2*" sic]WQKE?93-#ycO<(q^N=)qcSA*l]QB8-n\B6 xhWC+ |parm_scroll_rightparm_scroll_leftscroll_rightscroll_leftkey_suspend_charkey_kill_charkey_interrupt_charlinefeed_if_not_lfmemory_unlockmemory_lock_abovearrow_key_mapother_non_function_keysbackspace_if_not_bsalt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxon_characterxoff_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tab 1 Q˿[H<|yvspmjgda^[XUROLIFC@=:741.+(%"  ڽ׽}zwtqnkheb_\YVSPMJGDA>;852/,)&#  ~{xurolifc`]ZWTQNKHEB?<9630-*'$!  ޺ۺغպҺϺ|yvspmjgda^[XUROLIFC@=:741.+(%"   SLSrSlkzkkkinlmumlkobcS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXNXFRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtU$SEj]S(_jSj<)_EEE]SEPj(_ j!_P#_jSj(_ =4>h,th(j,P ? D]؉]ÐUSxu1=xt@ TreeToEiffel?gAssertiont_node->Kind == kAssertion0 || t_node->Kind == kAssertion1assert.c%s:%u: failed assertion `%s' ; gAssertion_clauset_node->Kind == kAssertion_clause0 || t_node->Kind == kAssertion_clause1assert.c%s:%u: failed assertion `%s' : eEntityt_node->Kind == kId || t_node->Kind == kEntity0 || t_node->Kind == kCurrent || t_node->Kind == kResultassert.c%s:%u: failed assertion `%s' Current Result eExpressiont_node->Kind == kId || t_node->Kind == kSimple_expr || t_node->Kind == kCall || t_node->Kind == kBin_expr || t_node->Kind == kUn_expr || t_node->Kind == kParenth || t_node->Kind == kManifest_array || t_node->Kind == kOld || t_node->Kind == kStripassert.c%s:%u: failed assertion `%s' ()old strip () eUn_opt_node->Kind == kAdd_unary || t_node->Kind == kSub_unary || t_node->Kind == kNot_unaryassert.c%s:%u: failed assertion `%s' +-not eBin_opt_node->Kind == kIntDiv_binary || t_node->Kind == kIntRem_binary || t_node->Kind == kMul_binary || t_node->Kind == kDiv_binary || t_node->Kind == kAdd_binary || t_node->Kind == kSub_binary || t_node->Kind == kPower_binary || t_node->Kind == kFree_operator || t_node->Kind == kEqual_binary || t_node->Kind == kNequal_binary || t_node->Kind == kLt_binary || t_node->Kind == kGt_binary || t_node->Kind == kLteq_binary || t_node->Kind == kGteq_binary || t_node->Kind == kAnd_binary || t_node->Kind == kAndThen_binary || t_node->Kind == kOr_binary || t_node->Kind == kOrElse_binary || t_node->Kind == kXor_binary || t_node->Kind == kImplies_binaryassert.c%s:%u: failed assertion `%s' =/=<><=>=andand thenoror elsexorimplies^//\\*/+-eType_listt_node->Kind == kType_list0 || t_node->Kind == kType_list1assert.c%s:%u: failed assertion `%s' , eTypet_node->Kind == kClass_type || t_node->Kind == kClass_type_expanded || t_node->Kind == kBit_type || t_node->Kind == kSimple_type || t_node->Kind == kAnchoredassert.c%s:%u: failed assertion `%s' bit like eClass_typet_node->Kind == kClass_type || t_node->Kind == kClass_type_expandedassert.c%s:%u: failed assertion `%s' expanded eActualst_node->Kind == kActuals0 || t_node->Kind == kActuals1assert.c%s:%u: failed assertion `%s' () eActual_listt_node->Kind == kActual_list0 || t_node->Kind == kActual_list1assert.c%s:%u: failed assertion `%s' , eActualeActual_genericst_node->Kind == kActual_generics0 || t_node->Kind == kActual_generics1assert.c%s:%u: failed assertion `%s' []eCall_chaint_node->Kind == kCall_chain0 || t_node->Kind == kCall_chain1assert.c%s:%u: failed assertion `%s' .eUnqual_callt_node->Kind == kUnqual_call0 || t_node->Kind == kUnqual_call1assert.c%s:%u: failed assertion `%s' eManifest_constantt_node->Kind == kCh || t_node->Kind == kTrue || t_node->Kind == kFalse || t_node->Kind == kInt || t_node->Kind == kReal || t_node->Kind == kBitseq || t_node->Kind == kStringassert.c%s:%u: failed assertion `%s' true false %ld%feManifest_arrayt_node->Kind == kManifest_arrayassert.c%s:%u: failed assertion `%s' , eListt_node->Kind == kList0 || t_node->Kind == kList1 || t_node->Kind == kList2assert.c%s:%u: failed assertion `%s' , , eStringt_node->Kind == kStringassert.c%s:%u: failed assertion `%s' [%s]Show list: %d: '%s' End of listclasses Failed to open CLASS table warning: possible structure alignment error: (table)->schema->rec_size == %d; sizeof(record) == %d; cluster_idclusters Failed to open CLUSTERS table ERRwarning: possible structure alignment error: (table)->schema->rec_size == %d; sizeof(record) == %d; cluster_id%s %sfeatures Failed to open FEATURES table warning: possible structure alignment error: (table)->schema->rec_size == %d; sizeof(record) == %d; class_idparameters Failed to open PARAMETERS table warning: possible structure alignment error: (table)->schema->rec_size == %d; sizeof(record) == %d; featureclass_idassertions Failed to open ASSERTION table warning: possible structure alignment error: (table)->schema->rec_size == %d; sizeof(record) == %d; typefeatureclass_idvisibility Failed to open VISIBILITY table warning: possible structure alignment error: (table)->schema->rec_size == %d; sizeof(record) == %d; codefeatureclass_id[%s]ENTER to continue Show list: %d: '%s' End of list%s.l,%sr %s ( : like ; ,): like "Unique: YESConstant: YESOnce: YESDeferred: YESVisibility: , ANYs %3d feature%s F1:Full comment Comment es %3d class%s F1:Full comment F3:Show code Information F1:Full comment F2:Full name s %3d cluster%s Comment Directory Version: %s Modified: %s By: %s Debug keys: %s Debug keys: None Source alias: %s.e Source alias: None %s/COMMENTr Comment %s/%s.e%s Can't open source code file (errno = %d) Error %d:|g0                               A:2) m`RL=.%zsk_RE>6. xk_VLB2!wseWK>1!ziU@+tj_TLC:3*&|qfa[P<3'{jXF<1&zma\SKC40*!           ~ t j ^ R G 8 .                     { u n g _ X P H A > 6 - $ Comment1Comment0CommentIdResultCurrentEntity0EntityString0StringBitseq_NONE_BIT_STRING_BOOLEAN_DOUBLE_REAL_INTEGER_CHARACTERRealIntFalseTrueChManifest_constant0Manifest_constantList2List1List0ListImplies_binaryXor_binaryOrElse_binaryOr_binaryAndThen_binaryAnd_binaryGteq_binaryLteq_binaryGt_binaryLt_binaryNequal_binaryEqual_binaryPower_binarySub_binaryAdd_binaryDiv_binaryMul_binaryIntDiv_binaryIntRem_binaryFree_operatorBin_opNot_unarySub_unaryAdd_unaryUnary_opStripOldManifest_arrayParenthUn_exprBin_exprCallSimple_exprComment_exprExpression0ExpressionAddrActualActual_list1Actual_list0Actual_listActuals1Actuals0ActualsUnqual_call1Unqual_call0Unqual_callCall_chain1Call_chain0Call_chainType_list1Type_list0Type_listAssertion_clause1Assertion_clause0Assertion_clauseAssertion1Assertion0AssertionEnsure2Ensure1EnsureRequire2Require1RequireCondition1Condition0ConditionActual_generics1Actual_generics0Actual_genericsAnchoredSimple_typeBit_typeClass_type_expandedClass_typeType0TypeLoop_body1Loop_body0Loop_bodyDebug_keys1Debug_keys0Debug_keysRetryDebugCheckLoopMulti_branchConditionalRev_assignAssignCall_instructCreationInstruction0InstructionConst_attrValIntervalChoiceChoices1Choices0ChoicesWhen_part1When_part0When_partWhen_part_list1When_part_list0When_part_listThen_partThen_part_list1Then_part_list0Then_part_listCompound1Compound0CompoundConstraint1Constraint0ConstraintFormal_genericFormal_generic_list1Formal_generic_list0Formal_generic_listFormal_generics1Formal_generics0Formal_genericsEntity_decl_groupDeferredExternalOnce_bodyDo_bodyInternalEffectiveRoutine_body0Routine_bodyFormal_arg_list1Formal_arg_list0Formal_arg_listFormal_args1Formal_args0Formal_argsFeature_list1Feature_list0AllFeature_listNew_export_itemNew_export_list1New_export_list0New_export_listOp_nameInfixPrefixOpIdent_nameFrozenFeature_nameNew_feature_list1New_feature_list0New_feature_listCreation_clauseCreators1Creators0CreatorsRename_pairRename_list1Rename_list0Rename_listFeature_adaptation1Feature_adaptation0Feature_adaptationParentParent_list1Parent_list0Parent_listLocal_decls_list1Local_decls_list0Local_decls_listRescue1Rescue0RescueLocal_decls1Local_decls0Local_declsRoutineUniqueConstantAttributeFeatureDeclaration_bodyFeature_declFeature_decls1Feature_decls0Feature_declsClients2Clients1Clients0ClientsFeature_clauseFeatures1Features0FeaturesDeferred_classExpanded_classClassClass_header0Class_headerSimple_index_clauseTagged_index_clauseIndex_clauseIndex_list1Index_list0Index_listIndexing1Indexing0IndexingClass_comment1Class_comment0Class_commentClass_declarationClasses1Classes0ClassesEiffelNoTree  ! !"#(%&'(+*+.-.1014345878;:;<?>?@CBCIEFIHIJMLMNRPQRUTUXWX`Z_^]^_`adcdgfghkjknmnqpqrutuxwx{z{}~ D%s %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%4d %3d %s%4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %4d %3d %s%s%*cTree: error in GetTree %hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%hd%hd%*c%d.%d.%d.%d%d.%d.%d.%d[%s]String overrun when concatenating. String overrun when concatenating. [%s]ENTER to continue Show list: %d: '%s' End of listrNo permissions to read[%s]Show list: %d: '%s' End of list%s.l,%sENTER to continue r[%s]ENTER to continue Reading file...rCan't open ''. %d%% shown. Interrupt! [%s]ENTER to continue <^q^j ~@to continue-Operating system error number-No file access permissions. Continue? ~No ~Yes ~?Help .<^q^j ~@ to continue ~?HelpD.Can't open filed.Can't get file's statusx.~Yes ~No.File: .<^q^j ~@ to continue.Directory does not exist.Unable to open file this for reading.Unable to open file this for writing/Unable to open file this for updateD/Directory: l/Unable to search directory|/Can't create new directory/Directory does not exist/This file is being used by someone else/Creating directory0This is a directory or special file 0File name too long to add lockH0This file is not a directoryl0Unable to create this file0Cannot change to this directory0~Yes ~No09%s %d/help/errors/errors.txtrCannot locate help files.Too many lines in 'help' file.Too many index entries in 'help' file.--.l.l.lYNQ ENTER to continue TERMTERM not set in the environment. cnormciviselrs1EON/Eiffel. (c) Eon Software 1993 All rights reserved Version %d.%d.%d.%d (patch level %d) EON/Eiffel. (c) Eon Software 1993. Version %d.%d.%d.%d (patch level %d) 22A serious error occured while the database was being processed. %s: (%d) %s Failed to open databasedas_open_dbEON_NOLOCKTable does not existdas_openFailed to open tabledas_openFailed to close tabledas_openFailed to delete tabledas_delete_tableNo memorydas_makekeySingle field onlydas_seekFailed lookup field namedas_seekdas_seekError reading recorddas_read Error %d: %s Extra information: Error %d: %s Error from STORE routine Operation system message: %s. Error %d from `das' routine "%s": %s Error %d from DI routine "%s": %s Error from STORE routineOperation system message: %s. Failed to get current directory namedas_fullnameFailed to change to database directorydas_fullnameFailed to get database directory namedas_fullnameNo memorydas_fullname%s/%sDatabase does not existdas_fullnameNo read permissiondas_fullnameNo write permissiondas_fullnameCan't return to local directorydas_fullnameOut of memory. %s: set is void s%s: set has %d item%s: [|%s%d] unable to allocate space for %d set-items $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/sterrs.c,v 1.1 89/10/24 10:09:14 mjr Rel $8777777record too smallno such recordrecord I/O errorbad record headerno record errorcannot open8%s 8%s: %s 8Seek errorRecord locking deadlock000000X8*DAT*d8p8x8%s: (%d) %s Too many databasesdi_open_dbNo memory for db namedi_open_db%s%c%sdatabases is closeddi_open_tableNo memory for table structuredi_open_tablecould not look-up file namedi_open_tablecould not open tabledi_open_tableunable to look-up index-file namedi_open_tableunable to bt_open/RO index-filedi_open_tabledatabases is closeddi_open_tableerror finding key in index-filedi_match_startunable allocate space for index-setdi_retrieve_setunable to read header in ib-clusterdi_match_startselect * from %s where %s = "%s" (unique) where %s = "%s" (non-unique) Unimplemented key typeKeyAddressUnimplemented key typeKeyAddressUnimplemented key typeKeyEmpty%u%d%d%ld%fUnimplemented key typeKeyDataWarning: key not in indexdi_find_uniquelocked record encountereddi_retrieve_setunable to read header in ib-clusterdi_retrieve_setunable allocate space for index-setdi_retrieve_setunable to read exising INDEX in ib-clusterdi_retrieve_setunknown read-flagdi_read_reclocked record encountereddi_read_recerror in `store_read'di_read_recread record size mis-matchdi_read_reccould not read extensiondi_read_recordunknown direction flagdi_traversetable has no indexed fieldsdi_traverseunable to allocate space for index setdi_traverseunable to expand index setdi_traverseunable to expand index set (key != unique)di_traverseunable to expand index set(2)di_traverseNo record has been selecteddi_delete_recordAttempt to deleted unselected recorddi_delete_recordcould not free store recorddi_delete_recordNo record to deletedi_delete_dupserror in index filedi_delete_dupsindex entry missingdi_delete_dupsUnable to read index cluster headerdi_delete_dupscould not delete recorddi_delete_dupscould not free store recorddi_delete_dupsUnable to read index clusterdi_delete_dupsCouldn't find key in clusterdi_delete_dupsCouldn't re-allocate for new cluster. di_delete_dupsCouldn't free old cluster. di_delete_dupsCouldn't re-insert new cluster.di_delete_dupscould not delete recorddi_delete_uniqueNo record to deletedi_delete_dupscould not free store recorddi_write_recordcould not allocate store recorddi_write_recordcould not write to storedi_write_recordcould not write to storedi_write_record(key exists?) Unable to insert into index %s'%s'di_insert_uniqueNo record to deletedi_delete_dupserror in bt_find index-filedi_insert_dupscould not create new INDEX clusterdi_insert_dupsunable to read exising INDEX cluster headerdi_insert_dupscould not allocate temp set spacedi_insert_dupsunable to read exising INDEX clusterdi_insert_dupscould not write swapped INDEX clusterdi_insert_dupsCouldn't free old index. di_insert_dupsunable to re-allocate a larger INDEX clusterdi_insert_dupscould not insert re-allocated INDEX clusterdi_insert_dupsNo memory for 000000 namedi_newdir%s%c%scannot access (existing) database dirdi_newdircould not create database directorydi_newdirobject exists and is not a directorydi_newdircould not change perms on existing databasedi_newdircould not allocate new file-namedi_newindex%s!%s%s%c%scould not open/create index filedi_newindexa+could not open database 000000 filedi_newindex%s %s %s could not generate new data-file namedi_newtable%s%c%scould not store_open (create) new data-filedi_newtable%s|%d|%d %s|%d|%d|%d could not write to schema to storedi_newtablecould not write to schema size to storedi_newtablea+cannot access database directory filedi_newtable%s %s %s error creating index on tabledi_newtablestore label record baddi_getschemaunable to read schema record sizedi_getschemaunable to read schema recorddi_getschemaerror copying header from schemadi_getschema%[^|]|%d|%d error copying header from schemadi_getschema%[^|]|%d|%d|%d error scanning in field descriptiondi_getschemar%s!%s%X %*s %*s %X %06Xerror in DI routine "%s": %s rcould not open 000000 filedi_read_dir0.tmpwcould not open 0.tmp filedi_read_dirrcould not open 000000 filedi_read_dir%s %s %s %s%c%sLocked - waiting. $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stalloc.c,v 1.1 89/10/24 10:09:12 mjr Rel $HFREE LIST DUMP %x %d: SIZE %d ADDR %x NO FREE LIST $Header: /atreus/mjr/hacks/btree/btdbmlib/RCS/stclose.c,v 1.1 89/10/24 10:09:13 mjr Rel $tj]C;tJ8u;t?EPwURUP/GFu 밐F랐EP+URUP/ GU9z~3t"PXCΐe[^_]ÐUWVSWDžlDžhDždhD`/CriD`XXP@Jر-jjPjjRhSXjjS} h$aS}S舀u?a]Ca]Ga]HaaV) u1V`SLpPtPxP|P pStSxS|ShQah0 `(`O mFPUF?BMLlNwV%QRcfb<l'=SqNnpvr|==#=H==S=RXx=Wj=X]jh]ahԈpP ` hԈp8 t@8 uhԈp P`Sm`j jhԈpP`H``ca 1t FO)ȃt hd`xh`]\ShԈpЈPK %`la t hd`\S {uua uDžl`~a a]a]a]`S`a t|dhn`>@V/~$[t[{}tjD`Pq>>}FEPD`PurEѐ}t1j=D`Pqh D`PqD`Pv>t/>]t*FEPD`P rEِ}D`Pq F> t > t>u)SW5EPD`P7sSWE0ҋ}щȃEN|EFj jV`à uF>/u}Kt3WD`PrE搐PD`PpEF} tD`PspE9P~!j D`PpEe[^_]ÐUWVS1=atUaE}0҃REPEP_E uF;ue[^_]Y@U WVS`UD@uEE?`t=Xu!jjSp EP.T+`XSPD`Sep EPD`SvEe[^_]ÐUWVSh`MQ_0ҿ`҉P)Ѓ(Pj Qo ((9P~j PKnڐTXh=ptp Q_;uDž(EP QhaS_haSF_,u 8$@ Džp,Ph$Q_ $0҉Ƅ.P$PDž DžDžaj/j/ QhaP_haQC_`0@48@<(4pQjP_ 20҉Ƅ~1ۀt)? uGR0PC,_G?t~OW0S _@@t@.t G?t?.uGj jWb_ 9t#Džaj jCP=_ j j Q$_ 9tMDžaj_ a(j j P_ =aus=at aPP_tJ0щʃuR^_aRPa_@Q PQPhbQ#_h 0ӉӉDЈ(Ԉh0ʃ҅uR_PQ(_jM_ b(PjQ_0҉Ƅ~P@QP tQ_P9d$1hbWi_ÃGhbWD_ǃt ڐ=h1h+$)Ј(Ԉh{q$0҅uR_$PQ(_\(`,Q_(p hǁЈhaEPh`_1[^_]ÐUl=p}]ÐU WVSuVEj_É]0хuQ_EVP_} 0хuQp_ECU RP_}0хuQ<_EUBEPUR_ElEP Ule[^_]ÐUWVS}@Dž|L-DždDžTDž`DžhDžlDžXDžtDžxDžLh@JuHLOP@D@@?t?}uꋽ@DW]S}_SozD1SÃtDt@DW;W=_u*{WFHP@[ Ȑu,jhb6TDž|L-Pf%0 ~ jjj-VjjTVk$DWh2b]SF_(SjtW ] HPV#VV<xtw1DWÃt`9l0щ`Ƅ ~ll1}t*; uCQ0RF_كC;t~KS0V_@@t@.t C;t;.uCj jS2_ 9tj jCP_ j jhP_` 9tj jhP_ VS'_trRjVxPVS_d0хuQg_`p0VPBp_Džtj jhP6_` 9t*hbxR_j jhP_1j.hRK_`thbxP_hRhbxP_h0щʃhbxPc_F@ShbxRJ_0щʃփ hbxP_`F`;~܋tRthbxP_ RjlP_l0щ`Ƅ ~dR@PUR} tP_%lRxPhbxR-_АhhbxP_1ۃ 9p~7Vj0RxPE0R_C9pЋxP_jhb7T[^_]ÐUWVS}1ۋM Q QhbuV_hbVG_|uV-xu|QjxQ_ TC}.xQt%tO}t0hhbW_EPWPhhbH}u АhhbWd_EPWhhbWJ_ W}tPhbW)_C9| АQW}txQW9}t АQWА1}t8hbW_C9| АQWe|Q_1l[^_]ÐUVSu] ;;@C<[tk<$<\<{;;}PChbV_ ;;}uhhb PChbV_ ;t;]uhhbP C; t<w)PRWPVT_PhbV5_ Ce[^]ÐU@WVShhb]S _ShcEP_0щ΃АPh cS_0щȃƃ$h#cEP_uF}O~hEPh%cEPr_e[^_]ÐUWVSRhpc]Sk_hcS _tuG(c(fcf,c.ptRjpR_ }-u}-t0pƄ~px|}t}=tx@x8t8=u鋅xx|Pbk|RkxPJkxRk|Rl1=Xc$Xc'|RRm_#'($(4(D(j jxR_ xRh( _xRhxRhxRhOOF? 3tRX_1d[^_]ÐUVSuE À8t;,uP.FCC;uPFe[^]ÐUURiURiEE<$t<#t#A<^t,:EPhc.EPhcEEEPhcURZ_E]ÐUU RhcUR_tc]Ð]ÐUWVSDž|-DžPDžTDžDDž@1j/j/Phc}W_hcWI_<uW%0ҋGuj_CCCCS]]Ð-UVSuE 9F|4}FF@P+ÃVRRS5_FRz+e[^]ÐUWVSu}|dU9V|\0M 9ЃFF@PF+ËURQS_U REPs_EPSG_Q*e[^_]ÐUWVS]M U9J|w|sM9J|kUJ+MM0EBP*ƋU RM QV;_S] S_E UEPS_ M Qc*U2e[^_]ÐUMQJx8 t8 uHJy|tDBQ]ÐUWVS] M9t]CAP*Ƌ}?WVE_0Ѓ)Ƀ  BKM Q)}7e[^_]ÐUWVS]u 0ЃC@Pw)VP_؍e[^_]ÐUS]E ~C@PH)؋]]ÐUE8tU RPY_]Ð]ÐUUE :tPR'_]Ð]ÐUS];tP(C]]ÐUWVS]u 0Љǃ;t9{!;t RT({GPY(VS_e[^_]ÐUVS]u ;tF9C";t R(FC@P (6VSK_e[^]ÐUWVS]u;t R'0} Љǃ9~{GP'WU RP7_e[^_]ÐUWVSu} ]>t RP'^CPU'S?WP_e[^_]ÐUWVS]0u ҋ3ЍDC@P&ƋM Q;WV7_P_ Q&3e[^_]ÐUWVS]E E0uҋ3ЍDC@P{&ƋMQ;WV_P_ QG&3e[^_]ÐUWVSuEPU RS_ >t R%0ЃF@P%SP4_[^_]ÐUWVSu} ]>t R%^CP%Kue[^_]ÐUWVSuh]S0}ЃU B=vhch `_U RSURSUUV}tUR$EEe[^_]UWVSu} h]SSGMA=~hch `I_?WSURSIMUV}tMQH$EEe[^_]US]jU RURURURURU R2?uj _CCCCSSNM]]ÐUS]RLC]]ÐUWVSu 1u>tj]C;tJ8u;t?EP;\URUPGFu 밐F랐EP[URUPa GU9z~3t"P"Cΐe[^_]ÐUEU P$Wtu1]ÐT]ÐUWVSUBz|}M9y~c]KUB QPY_~"UB MMAU)yEUM9Qe[^_]ÐUS]SCR\S9S~CL B9SK]]ÐUWVS}1'jVO QGGRO QHF9w~=9w9w~3jVO QG1ۃ 9_~j O QAFC9_F9w΋ WyJe[^_]ÐUWVS}19w~2jVG PlG1ۃ 9_~j G PEC9_F9w΋ WJe[^_]ÐU WVSuE}jN QN QFjN QDVFRN Q GN QE V(WNQBPBjN QN QFEPN Q]Là jN QN QFN QDVFRN QFV(WNQB PB$1$tE==4=RtY=S1҃~rFH9f>t NB~JFH9|=1ҋN+N MF9FFH9 ^KM9^} FBEF9FFH9|~NN~ tN 8FH9FFFH9F uF F(MQP(R@,ЉE^CMQS_tMQ _EE9^u19^FP _t"FP_F9EtFH9u 1C9^u9^9F9}+FF ^z9^~fti>tN N9^u>F+F F9F~F F9^uЅVrrFe[^_]ÐU WVSu 1hJdVT_u'=< ` u VhLdWUB1E@dhXUBPhV_ tE0щƄ VEPRCPW뫐R_EX؍[^_]ÐUWVSu} WJ|8u J񐐐BFPWF1ۃ9^~SF@PWVNQPFP_FFNQFPTC묐e[^_]ÐUWVS]u}jU RURWVURU R6C PCs{C CCUSe[^_]ÐUWVS]u}jjURWVURU R5C s{C CCUSe[^_]ÐUVSu~tH19^~FP8UC9^VR&UF~ tV R94F e[^]ÐUVSu] F(X@VtVe[^]ÐUEURU R@ PAH]ÐU]ÐU]Ð? @@@P@ 7US]jU RURURURURU R24uj _CCCCS]]Ð@US]jU RURURURURU R3uj_CCCCSSA]]ÐUS]R=AC]]ÐUVS]u jjPjPR:EHjPR> VR>Ro?RDAV8Se[^]ÐUS]HjPR4> R)?R@8S]]ÐUVS]u HjPR= VR>R>S@e[^]ÐUS]HjPR= R>R^@C8tPS]]ÐUVSu R_Ãt6VG ؍e[^]ÐUWVS}] j=R:4tW4RjR< R=Ȉ+CG49d~ dW4w4VjR< j RG;;t95Ȉ~CPR$;Fސj R;R:?WL?e[^_]ÐUVS]u jjRE< j=R:j R:RRM<j R:R5:R<jȈRjjRBFPjR; jxR!<Vdj=R9R<R9FPjR~; jvR;SF>e[^]ÐUUjjPjPRAUEtss]ÐUS]C08ICCC8hHj_,j=SHȈCD jjj=PRjjWFdMDP)3> t>uFCu d}LQQ7}jdDPS6IQdDP=4 dQdDPWVAQdDP6IQdDP3$ dQ]SWjSdDPs dLQw'N}~*}W_dMDPO'& d}LQdW6e[^_]ÐUU E8t38\u @#8~u@8@u 8?u@ B@8u]ÐUSE ]ڀ8t8~u x@tJt@8u))؋]]ÐUWVS} ]1;<^tR<\tlz<~ulC;@tx;?uCtmj W0PW 1W0PCt<PW2-Ct PW0FC;\e[^_]ÐUVSuEPM QS_SQ2ffBPf@fBN[^]ÐUWVSu} N hVhN hU:t!MQWRn1 M QR1M QS_SWURQbǃt"URS̾_F hNSUR[^_]ÐUS]jU RURURURURU RJ%uj"_CCCCS]]ÐxOU@VSueEPVɽ_tf}@ufhhjSV|e[^]ÐUhhjeRURQ]ÐUjhjgRUR$]UjjeRU RUR]ÐU(WVS] 1DžDžDžȈPEP|Pl_ȈƄ(t t4ȈPSPB_ȈƄ( ƅ=ht=\ePhs |ePhs gPht h0ҍ|щ˃Et=eEt=fщȃÀt0Љƃ9~Et#0=eЍp9~}t(Et \eEt g|eEEP_ 9~EPI ÃȈJ)ơȈ9~ ȈjjjSPVP"ǃu1mW/jjDžWJ-Et eEtfPWP-Et#hW +|PW/-|PW-EtRjP@W, =< ` u8ePW,< `PePhhWM-t&jP@Wk,PW,}tKEt\eNEtg3|eEPht jPW+PW] P HE$Dž}t|uEt=PP@PPWo+jttsSajPWE+jshsWƃAPP@PPW+jthtWƃ ށWu4Džu.tl9uDžPB;~u'{?u!C9uj EPW9Dž C;u΃]W[^_]ÐUSE] ڀ8t8~u x@tJt@8u8u))؋]]ÐUWVS}EE1E=htD eQhth$; u9u}u1E FC;u9u}uȈ9E~E8}EȈJM)jjjQEPVMQLEP3+E ; t;uBjMQAMMQ( PGMQ'? t?uGCujE@PMQQ( eQMQ hQMQ1&MQ3*H9}j MQ&Fސ1jht@PE@PMQ'jhtMQr Ƌe ;~u%{?uC9uj M QMQ C;uЅuMQ;e[^_]ÐU WVSu1E1E} u: hh(tPh(t=h;t%; u9~1E @C;u9~ǡȈ9~7 ȈIG)} uEjjjGPEPhPEPh(tP(E ; t;uKjURBUh(tP.& PFh(tP$> t>uFCuh(tP(} jh(tP'HPh(tP%eRh(tP%jeR@PURh(tPo%(eRURx} ~*U Ru_h(tP%h(tPh'e[^_]ÐUWVSȈHjjjjFj PMQEV-' =huVtjjjV$1ۃ j|V #CE~M M 9 h~O\wE9EPV身_tfEf%f=t&hheP`gPVdE}sE tc0ЃP2VW蔫_hhWi_jWɞ_uhheP gXW"2UV0E0ҋ}щ@=v4hhePgPVщȃP2VWʪ_hhW蟪_jW_ƒuEURƞ_BE t<щȃP1VWc_hhW8_WB_EW1Ee[^_]UjhhUR ]ÐU WVS]u }EPEPS$ EPS!tKt'Ev }Wu]}WuD?U `Pt"%9u `ЉE:t9EtlB:t9Eu9EtV `9 `wjh `虛_ `h ` _MQMQSCEe[^_]ÐUVS]u thS hhS,Sr t hSe[^]ÐUWVSu0Eh0{h,{=hth,{8{hh0{+h4{h%أ${h${h$ {h h=ht PhЃhtE0}Ѓ9h~U @9h({UE 4{PURV EPVWu%EPURURU RURVEtE=\J=D===M#=J=Kt1=O5=Wu=h%h=hPhЋE 0{PURV{=0{u'={Z `9 `$=hu' 0{=4{ 4{0{9({u ({ 0{0{U =4{u" hj0{PURU RV# ( 4{E 4{PURVhRV!=0{ 0{=ht2=4{u) hjEhPURU RV4{ 4{o0{9,{9({U ({({4{98{u4hjEhPURU RV44{0{4{R0{RURU RURVpURURU RV={tG `9 `wjh `N_ `h `轙_TH({U=${u R${0{h${hhhEe[^_]ÐUWVSu }]0{9({uL `9 `wjh `{_ `h `_ST@9({({D 4{R0{PWPURW ({({4{PWURe[^_]ÐUWVS}] uUMM0{9({= {tK({9,{u> `9 `wjh `腔_  `h `_({90{ LH90{~({9,{t({({0{M 4{98{ujhPVS!P0{PV4{PW4{PVWe[^_]ÐUWVS}] uht, `Xt%9u ` ؉Ã.M=${uV${=${u]=hth+h90{|A `9 `wjh `_  `h `}_M9t^ht=0{uLVJu8S t+ hQjMQMQVW]0{M=${u1Su$ `9 `?Nht/tΡ0{9,{u=hu 9({00{0{9({}({({04{98{uIhjhPMQMQWE4{PMQWn 4{SWtSVMQMQWp0{9,{~F0{4{98{~-4{E4{PMQW h.=${=hh+hP 0{QV h+ h 0{1҃ 9h~0{00B9h0{h({0MQMQW>VWgE4{PMQW#e[^_]ÐUWVS] u}EPWURE 9,{~ @9,{U({4{R0{PWPUREPWURe[^_]ÐUUBЃ vBӃw ]Ð1]ÐUU=hu"1]Ð {1]ÐB: t:t< v <v: uB:u]UWVSuMIE Hljx 02HJ}) 0 Hye[^_]ÐUWVS}u]U RURW{ -> u hRPW FC>t98{ԍe[^_]ÐUWVShi5_Ãu$hih `%_jf_Zh'i!ÃtjSh|}˛_ |}0Ѓ}h-i׃ÃtjSh}聛_ }0Ѓ})s)~' }Qh}j_> u h~CPWPU蒈 CU~F~̍e[^_]ÐUjHPRfRcRWh3iւt P-&h6i輂t P&e}Rh|}j,_]UVS]S" QduCTSUhH9u hh8{8t195h~K<{xTu0@Rt PjB@PjRMcPCVF95h(1e[^]ÐUWVSMMMMM MMM=hu1h=hjX7 fMfOfMfOfMfORMME %Et MIMMIM MMMMUU9|EE9Ȉ| }|} }1M QMQPRVjjPMdEPQ1$9u~5MQPQ#d1ۃ 9]~j QZC9]F9ufM fO fEfE fEMffHfGfMfOfEfEfEffHfGfMfOfEfEfHfGfMfOfEfEfHfG E ffOGVG} uMM O fEfGLG$ hOUfGPfGNGTh<<{hfDw@NyMt jMt jW`Mt jWMMt WLGPPQbjQ]ke[^_]ÐUWVS]u0PU D(VPh_ } U $wwx(xwx(xU fDS@LVSy U fDS@40ЃfSf)‰fCU fDS@CRtjCRt jS"jSS e[^_]ÐUWVS}fGRfMG PQGW )+EPGW)+EPjjW1f|w@tMDw@P~GW)+E1PQ a\( ;tPCQW;uF~VuGGLP?WTe[^_]ÐUWVSuFR %EFPFPVCà teFS )PFS)P;Wd` tP(HFEPj>W1` t S>WVF PFPVà tdF S )PFS)P;W_ tP(HjFEP>W_ t S6V@Ve[^_]ÐUWVS}GR %EW=huG$ @PQGPGPWà teGS )PGS)P Q^ tP(H%GEPVQ^ t'؅}C$)É PQUFGU9'G PGPWà teG S )PGS)P Q ^ tP(H%VGEPQ] t'l؅}C$)É PQ&TFGE9+=huG$ @!Be[^_]ÐUWVS} hxR<{zTu5.ΐ\5ܱPW9]~PWC9]VW=huG$ @!Be[^_]ÐUWVS]M UCR tJIC )C)lj}| |C9|C9Ȉ}RQ;Wnfsfsfs fsf}f{f}f{ f}f{f}f{1 95h~Z<{xTuA@Rtj @Rt jPR@Rt jP?@Rt P>F95hj1e[^_]ÐUWVSE <9E ~E}f1}f~s19 h~]] E<{}zTu8;u3}GU9t(B 9E|B9E|B9B9EA9 hF}G9|E}G9Ene[^_]UWVS}] MMMMM=huG$ @PQ MQSWPW7uF9u~PWF9uPWs9uMQVWYԐPW}tb=huG$ @!B] j WC9]=hu4G$ @PQF MQVW ԐPWTF9uSMQMQWPW+uF9u~PWF9uؐPW=huG$ @!Be[^_]ÐU塜 `9 `w jh `Lt_ `h `w_]ÐUWVS];=hu=huC  @PW U9UuAu 9u^URVWaMԐPWCF9u}6U9U u8]9]URVWMPWCC9]}URU RWLPW|C]C9]~PWbCC9]PWKCu F9u~AURVWLԐPW#CURVWxL ԐPWCF9u‹URURWPLPWB]C9]~PWBC9]ؐPWB=huge[^_]ÐUSԐ|-ؐ++++9eQ|{M3$ȐؐhXxH(8\ܱԐ~n^ؐNl>.pć9h]]Uh@ix_hcix_jjjjjhxix_]ÐUhix_jjjjjhix_]ÐUSEU M]]]ÐUWS=iu\his_Ãt?0ЅuPv_iSPA|_iiie[_]ÐUS]U Rj/nPhiS{_]]ÐUWVS]0PSV{_e[^_]ÐUUBu 1]Ð: t: uЉ]UU 8 t8 t]ÐUWU:t0D}]ÐUWS]0Ѓxڐ: t: uJHy|tDe[_]ÐUWS]0ЃU ) CJe[_]ÐUE€8t:/uBB:u]ÐUWU0Ѓ9v8.u H9w}]ÐUS];tN9t `t#9t `C;u]]ÐUS];tN9t  `t#9t `C;u]]ÐUEuhjh `o_Fl_Po_]ÐUWVSu] 0PZs_uPS6Vx_e[^_]ÐUSURs_Ãu؋]]ÐUhj?t_j n_UE`U P1]ÐU塤0Pj@P/y_1]ÐU塤 Pj@Px_1]ÐUEv]Ðt; tUtul t^h@j It3h@jth@jP?1]ÐU塤@]U塤@ ]Uj@Pw_=t$ƀƀƀ1]ÐUS0Pj_v4D ,1һ0j 90jtBv]]ÐUh}@P=w_1]ÐUh}j@P3w_1]Ð@B A$@@@UWVSu/EEu\\E}>$tPMуSF>.uj>V)u_uj$MjMyu؀>.u(F `PtBP$E]F>*u EM ]Fft]9E|QzhuK}M ]E]Eu}WMуEE]Et>t F>1e[^_]ÐUh@jUR]ÐUƀǀƀ`<`0`4@G@F0Pj@Pt_t 1]Ð]ÐUǀ`t_t1]Ð]ÐUƀJ<0PjBPs_t 1]Ð]ÐUƀH0H40Rj@Pys_t1]Ð]ÐUƀǀH<H0H40Rj@Ps_t1]Ð]ÐUǀJ<0PjBPr_t 1]Ð]ÐUƀb<0PjBPfr_t 1]Ð]ÐUƀƀ`0`40Rj@Pr_t1]Ð]ÐUMPB9BwPR0c_@P @1]ÐU WVSEEEEPEPj[o_ =u+ tCT@ܐxtPKܐxtP/@71fx~~(@,fh@jPǀǀ_trǀǀjjPjǀǀh@jP?ǀǀR~9}ejSPS-ǀh@jP @~9|jjQPǀǀ]]ÐUWVS8udhh@j8P }  }7=jV MYzC9uxQ~@(D\ܐذ9BtBh@PXPB9Bw%PR?_@P@k=}GzH9_~ƃt!h@jQ VCPjjR8dh@j8P@(D ܐذ9BtBh@PWPB9Bw%PR>_@P@h@jdPD K9h@jP@(D ܐذ9BtBh@PVPB9Bw%PR;>_@P@ܐ9BtBh@PkVPB9Bw %PR=_@P @Cz9|+{UtǂEM h@jdPlh@j} WlPAP M1=j^=}_zC9|W~@(D\ܐذ9BtBh@PUPB9Bw%PRj<_@P@k MAzH9Y~ƃt!h@jW VCPjj8dh@j8P9@(D ܐذ9BtBh@PSPB9Bw%PR];_@P@h@jdP K9h@jP@(D ܐذ9BtBh@PDSPB9Bw%PR:_@P@ܐ9BtBh@PRPB9Bw %PR@:_@P @Cz9|+{UtǂEM Oh@jP4}7 =jc MYzC9Q~@(D\ܐذ9BtBh@PQPB9Bw%PR9_@P@k=}GzH9_~ƃt!h@jQ: VCPjjr8dh@j8P@(D ܐذ9BtBh@PPPB9Bw%PR 8_@P@h@jdPd K9h@jP7@(D ܐذ9BtBh@POPB9Bw%PR[7_@P@ܐ9BtBh@POPB9Bw %PR6_@P @Cz9|+{UtǂEM } e[^_]ÐUS]`tFh@jS`P+;P-h@jP Kuߋ]]US]jURU RSY S1]]ÐUE9ܐu@P]ÐUWVS} }MAa ߉EA=}MA,}f] pt} WpP./P 0tPM } uMAPPjj$j}G6W4)@PRW<1e[^_]UWVS}7GO(WUEM]9w+9 tMuG(+؉ 9Msփt6O,q9f hDP( hHP hLPh PPh!TPh"XP h#\Ph$`Ph%dPrh&hP\ h'lPCh(pP-h)tPh*xP h+|Ph,Ph-Ph.P h/Ph0Pwh1Pah2PK h3P2h4Ph5Ph6P h7Ph8Ph9Ph:P h;P|h<Pfh=PPh>P: h?P!h@P hAPhBP hCPhDPhEPhFP hGPkhjXPUhk\P?hP) hKPhIPhPh[P hl`PhmdPhnhPholPs hRPZhppPDhqtP.hSP hrxPhZ|PhsPhtP huPhvPhwPxhxPb hPIhyP3hzPh{P h|Ph}Ph~PhP hPhP}hPghPQ hP8hP P"hP hP hPhPhPhP hPhPlhPVhP@ hP'hQPhPhP hPhPh PhP hTPqhP[hPEhP/ hP}P]ÐUWVSufU fU=j=}t^=}[C8t {uC8uF>;Րj _Ct&[hj _}É߅uIjfj _Åu.jtG;S_u3CSFfC >ufUfS e[^_]UWVS<+8+0+4++ +++$-@|+~,_+:'#Xo< >v^## #(th@j(RӤE0ҋ҉Ӄ9]=MоS9$66666666666666666666666666666666666666666666666666666666666MAM4@4`E9]Ne[^_]UWVS]1C(4{ttP茤%C(|9v1e[^_]ÐUVSu1ې`RV_uDTC$~ָe[^]ÐUVSu1ې`"RV_uDXzC ~ָe[^]ÐUVSu1ې&RVN_uC~Ӹe[^]ÐUWVS]1S6C(4{ttPuC,fPC0f{f9v1e[^_]ÐUWVS]u }S A~H9SAzH9~ fsf{ jC@PjS1e[^_]Got a segmentation violation signal, cleaning up and exiting U} uhh ` _jY _UWVS]u EPV _PS! ^h_D `u}< `u@ `< ` p0 Hǀǀ@ƀƀǀƀƀƀƀƀ,t,PvjjBzPB~PFjjBzPB~Pܐ H ܐH @ܐ@11jx=xtmj{tI;} ȈQjHPj ȈQjVFQjSPCЃ Gjj8uEhXEEj]SjY_EPEEjSj:_=u6jVBzPB~)Pu1e[^_]ÐUUu1]Á=js$jM Hj1]Ð]ÐU塤`u]Ðh@j`Phftʡftj1]ÐUSfMfU f]f~+9| f|9~f| 9ɀˆ`‹]]ÐUVSfuf] fMfUhf9~uxqufhwcfdw]fdwWxqufwEfw>fw7h@jPPPPhPgP1e[^]ÐU塤@o]U1`tCft9ft/tt xuXt\t]ÐU]ÐUVSu MfUf~ 9}-Š`ff`f%ff91e[^]U$WVS]ujUR_1}}E U܉E})EURjjh}CSJ_jMQ=_}+}E)E܉EU+UM)щMy~ ME@B}}EEt$}E)ǍUE}<>؍e[^_]ÐUEj]TIOCGWINSZUEPhTMQ\_ }!h _]ÐEUȈt҅t1]def_shell_mode() tcgetattr() failed:U塤 P@PA_uh _j_@tǀǀ1]def_prog_mode() tcgetattr() failed:U塤0P@P_uhw _jX_`41]|UVS]u SP^ _hS _t3VP5 _u hj _u1[^]/usr/lib/terminfoTERMTERM environment variable not set. Not enough memory to create terminal structure. TERMINFO%s/%c/%s'%s': Unknown terminal type. CCLINESCOLUMNSUWVSuu8h'_ƃu%}uNh,h `_j_Vhȇ0hd_ǃuG}t!UhPh `_jV_h_tVPShR _VPhhS _(WR}NWS}@}tU1dVhh `d_j_=th3_thPhȇ _LjfU fPh_tj jP _ h_tj jP _Ȉ =ju&fx~~fxz~P~@zȈ=~ =Ȉ4U Ru&fx~~fxz~P~@zȈffP~fȈfPz}t U[^_]ÐUU1]ÐUS]t%{t SR_S_1]]ÐUVSh_EE1ې1ҡƋ8t,M8 uM B5<uC~e[^]Ð%d%02d%03d%2d%3dUWVS]u1Z U 1ɐr4@A~<~d@~; ;%t#5dd CЃ] $$T   $  t  DT dt   4    d%d" =<~~' <~<~E}1Rhd;C< C;d 2u2=<~~ <~<~E}1Rhg>=<~~' <~<~E}1Rhl5dV_ =d0щ΃5d C;d =<~~ <~<~E}1Rhq>C;d=<~~ <~<~E}1Rhu5dVh_=d0щ΃5d l=<~~' <~<~E}1ҡdd!=<~~' <~5<~u}1RdP_=d0щ΃5dC<|~xC<x=<~~ <~5<~u}1}DC<(}C=<~5<~u}<~C1TBC< v=<~~' <~5<~u}1҃=<~~% <~<~E}1!=<~~' <~<~E}1҃=<~~% <~5<~u} 1)щ=<~~' <~5<~u}1҃=<~~% <~<~E}1@=<~~' <~<~E}1҃=<~~% <~5<~u} 1ɉȉ֙=<~<~E}<~=<~~' <~5<~u}1҃=<~~% <~<~E}1ɉȉ֙F=<~~' <~5<~u}1҃=<~~% <~<~E}1!=<~~' <~<~E}1҃=<~~% <~5<~u} 1 k=<~~' <~5<~u}1҃=<~~% <~<~E}11=<~~' <~<~E}1҃=<~~% <~5<~u} 19=<~~' <~5<~u}1҃=<~~% <~<~E}19Ѓ=<~5<~u}<~=<~~' <~<~E}1҃=<~~% <~5<~u} 19x=<~~' <~5<~u}1҅8=<~~' <~5<~u}1҃=<~<~E}<~@D=<~~' <~5<~u}1҅C1Ҁ;;%u,C;?u B#;;u ~\J ;eutL;tVC;u?C1Ҁ;t<;%uC;?u B;;u~ J;tC;uӀ;t C;d@~e[^_]ÐUU RURURl]couldn't open terminfo file %s. The terminal you are using is not defined. UWVS]jS%_$},Shh `_h=h `_j_j EP$W _ trfUEff fEfUEff fEfUEff fEfUEff fEfUEff fEfUEff fEf}TE~Ph$W`_OM  f}~jEPW_ E%~%PE TP$W_ f}%~jEPW_ ]$M D TC$~EUШtj+P$W_ u7EB~BPE zP$Q_ ~1ېE!~!9}Zj(P$WA_ (u)uM fDYz!f()ff Ћ} fD_zCf}!~)jEEP$Q_ &] } fD_zC ~=t;EuPT_M Au%$WVM AP} ~ Dž Dž , d~dPW$Q_ƃ 1ۉ9ى؋<8u|8t/؋D‰Ћ} G1} C9|x1ۉ9}\ډ؋f<8t8M A1} C9|) f}~+jEEP$Q=_ /]} DŽC~EPM IQ$WA_W_E9u1$Q_[^_]ÐU1]ÐUE`t<tjj]Ð<t @j j?j]UVSE] u!Sj``f`fXtSjPXRSjPtPPs \tSjP\R SjPxPP#e[^]ÐUWVS}u u XtVjXytqVjPPPPPPPPPR(Pl~Xtbj@t%TtVjTP5~%j =jVjXP~js#j@t TtVjTP} t htVjhP} t htVjhPu} t htVjhPM} t htVjhP%} t htVjhP| t ltVjlP| t htVjhP| t htVjhP| jЉ!@t  tVj PR| t $tVj$P*| t (tVj(P| t 4tVj4P{ t DtVjDP{ t HtVjHP{ t @tVj@Pb{ t <tVj<P:{ t LtVjLP{ =jt%9jt jVP=j1e[^_]ÐUh@UR]Ð}zwtqnkhea\YSPMJFA<71-'# lpixcpixsamxvpadaisycrxmxhpahlsbcecccndscrnpcnrrmcchtsmc5inxonxonulhzxteslokosmsgrmirdbdainhskmhcgneoxenlxhpxsbambwn!\!P!;!(!! !!        s ^ Q ; 2 #   o_H8(lpi_changes_rescpi_changes_ressemi_auto_right_marginrow_addr_glitchhas_print_wheelcr_cancels_micro_modecol_addr_glitchhue_lightness_saturationback_color_erasecan_changenon_dest_scroll_regionno_pad_charnon_rev_rmcuphard_cursorprtr_silentneeds_xon_xoffxon_xofftransparent_underlinetilde_glitchdest_tabs_magic_smsostatus_line_esc_okover_strikemove_standout_modemove_insert_modememory_belowmemory_aboveinsert_null_glitchhas_status_linehas_meta_keyhard_copygeneric_typeerase_overstrikeeat_newline_glitchceol_standout_glitchno_esc_ctlcauto_right_marginauto_left_marginZ"W"T"zwtqnkheQ"N"YK"PMJH"E"B"?"<"9"6"3"0"-"*"'"$"!""""YGYFYEYDYCYBYAhlutccNDNPNRHC5inxxoesmsmixnxsxb#~#x#u#q#n#k#g#b#_#\#Y#T#M#G#C#=#7#1#+#%#!##### ###""""bitypebitwinbtnswidcscpsorviorhiorlorcnpinsmlsmcsmjumpmaddrspinvspinhbufszncvpairscolorswnummalwlhnlabwslvtpbxmclmlinesitcols%%x#%%%%%}%p%d%U%E%:%0%!%%%$$$$$$$$j$U$J$;$3$$$bit_image_typebit_image_entwiningbuttonswide_char_sizeprint_rateoutput_res_vert_inchoutput_res_horz_inchoutput_res_lineoutput_res_charnumber_of_pinsmicro_line_sizemicro_char_sizemax_micro_jumpmax_micro_addressdot_vert_spacingdot_horz_spacingbuffer_capacityno_color_videomax_pairsmax_colorsmaximum_windowsmax_attributeslabel_widthlabel_heightnum_labelswidth_status_linevirtual_terminalpadding_baud_ratemagic_cookie_glitchlines_of_memoryinit_tabscolumns&~#&u#&n#k#&&_#\#Y#&&&&&&&&&&&&&&&&&&&&|&YpYoBTYnYmYlYkYjYiYhYgYfYeYdYbYcYaNCpaCoMWNlwssglico4444}4w4t4q4m4g4c4^4Y4S4N4H4B4=4:454/4*4&4"44444443333333333333333333333333333|3v3q3k3e3a3]3Y3U3P3L3H3D3@3<3834303*3$33333 3332222222222222222222222222222222y2u2q2m2i2e2a2]2Y2V2S2O2L2H2E2A2=2825212.2+2%2!22222 2221111111111111111111111111~1y1t1o1j1e1`1[1V1Q1L1G1B1=18131.1)1$1 1111 11100000000000000000000000000~0y0t0o0j0e0`0[0V0Q0L0G0B0=08030.0)0$00000 000//////////////////////////|/w/q/m/h/b/]/W/R/L/G/D/A/>/;/8/5/2///,/)/&/#///// ///........................~.x.s.m.f.a.\.W.R.N.I.C.=.7.2.,.'.".... ...----------------------|-u-o-i-c-^-Y-S-M-G-B-=-8-3-.-)-$------ -srslsr1sl1UWkzUWkkUWkiOTnlOTmuOTmlOTmaOTkoOTbcscesascescpctrmrmscsmscrmpchsmpchdispcslinessetcolorendbidefbicolornmbicrbinelbirepsmgtbsmglrs3dss2dss1dss0dscsindevtpfxlsetabsetafgetmreqmpminfokmouscsnmzeromdocrsupcssubcsrcsdrbimscsdsbimsmgtpsmgtsmgrpsmglpsmgbpsmgbscsmcuumcufmcubmcudpordermcuu1mvpamcuf1mcub1mcud1mhparumrsupmrsubmrshmrmicmrlmritmrwidmsumssupmssubmsshmsnrmqsnlqsmicmslmsitmsdrfqswidmdefccvrchrlpicpisetbsetfscpinitpinitcocopu9u8u7u6u5u4u3u2u1u0waitpausehookpulsetoneqdialdialhupwingocwinrmclkdclksclkflnsmgrsmglmgcel1kf63kf62kf61kf60kf59kf58kf57kf56kf55kf54kf53kf52kf51kf50kf49kf48kf47kf46kf45kf44kf43kf42kf41kf40kf39kf38kf37kf36kf35kf34kf33kf32kf31kf30kf29kf28kf27kf26kf25kf24kf23kf22kf21kf20kf19kf18kf17kf16kf15kf14kf13kf12kf11rfikUNDkSPDkSAVkRESkRITkRPLkRDOkPRTkPRVkOPTkNXTkMOVkMSGkLFTkICkHOMkHLPkFNDkEXTkEOLkENDksltkDLkDCkCRTkCPYkCMDkCANkBEGkundkspdksavkreskrstkrplkrfrkrefkrdokprtkprvkoptkopnknxtkmovkmsgkmrkkhlpkfndkextkentkendkcrtkcpykcmdkclokcankbegrmlnsmlnenacsxoncxoffcrmamsmamrmxonsmxonkcbtplnacscrmpmc5pkc3kc1kb2ka3ka1iproghuuctslhtwindhtssgrriindscvparcrfrs3rs2rs1repmc5mc4mc0pfxpflocpfkeycuurincufcubilindnichcuddldchpadnelsmmrmmlf9lf8lf7lf6lf5lf4lf3lf2lf10lf1lf0smkxrmkxkcuu1khtskrikindkcuf1kppknpkllkcub1kil1kich1khomekf9kf8kf7kf6kf5kf4kf3kf2kf10kf1kf0kedkelkrmirkcud1kdl1kdch1kctabkclrktbckbsipil1ich1ifis3is2is1fslffflashrmulrmsormirrmdcrmcupsgr0rmacsechsmulsmsorevprotinvissmirdimsmdcsmcupboldblinksmacshddsldl1dch1cvviscuu1llcuf1cnormmrcupcub1civishomecud1cupcmdchhpaedelcleartbccsrcrbelcbtMMMMMMxMpMaMOM@M4M(MM MLLLLLLLLL{LdLSLCL5L#LLLKKKKKK}KiK\KKK:K'KKKJJJJJJJJJJvJlJcJ\JUJLJDJD4D&DDDDDCCCCCCCCCCCCCCCC~CvCnCfC^CVCNCFC>C6C.C&CCCCCBBBBBBBBBBBBBBBB~BvBhBXBGB:B0B"BBBAAAA]/W/AAAAAAAAAAAAAwAkAZAJA;A,AA A@@@@@@@|@k@Q@<@*@@???????}?g?V?A?6?+?? ??>>>>>>>~>i>S>D>0> > >=========s=i=X=G===1=#== =<<<<<<<<r<]<N<><.<<<;;;;;;;q;_;Q;>;+;; ;;:::parm_scroll_rightparm_scroll_leftscroll_rightscroll_leftkey_suspend_charkey_kill_charkey_interrupt_charlinefeed_if_not_lfmemory_unlockmemory_lock_abovearrow_key_mapother_non_function_keysbackspace_if_not_bsalt_scancode_escscancode_escapepc_term_optionsexit_scancode_modeenter_scancode_modeexit_pc_charset_modeenter_pc_charset_modedisplay_pc_charset_page_lengthset_color_bandend_bit_image_regiondefine_bit_image_regioncolor_namesbit_image_carriage_returnbit_image_newlinebit_image_repeatset_tb_marginset_lr_marginset3_des_seqset2_des_seqset1_des_seqset0_des_seqcode_set_initdevice_typepkey_plabset_a_backgroundset_a_foregroundget_mousereq_mouse_posmouse_infokey_mousechar_set_nameszero_motionthese_cause_crsuperscript_characterssubscript_charactersstop_char_set_defstop_bit_imagestart_char_set_defstart_bit_imageset_top_margin_parmset_top_marginset_right_margin_parmset_left_margin_parmset_bottom_margin_parmset_bottom_marginselect_char_setparm_up_microparm_right_microparm_left_microparm_down_microorder_of_pinsmicro_upmicro_row_addressmicro_rightmicro_leftmicro_downmicro_column_addressexit_upward_modeexit_superscript_modeexit_subscript_modeexit_shadow_modeexit_micro_modeexit_leftward_modeexit_italics_modeexit_doublewide_modeenter_upward_modeenter_superscript_modeenter_subscript_modeenter_shadow_modeenter_normal_qualityenter_near_letter_qualityenter_micro_modeenter_leftward_modeenter_italics_modeenter_draft_qualityenter_doublewide_modedefine_charchange_res_vertchange_res_horzchange_line_pitchchange_char_pitchset_backgroundset_foregroundset_color_pairinitialize_pairinitialize_colororig_colorsorig_pairuser9user8user7user6user5user4user3user2user1user0wait_tonefixed_pauseflash_hookquick_dialdial_phonehangupgoto_windowcreate_windowremove_clockdisplay_clockset_clocklabel_formatset_right_marginset_left_marginclear_marginsclr_bolkey_f63key_f62key_f61key_f60key_f59key_f58key_f57key_f56key_f55key_f54key_f53key_f52key_f51key_f50key_f49key_f48key_f47key_f46key_f45key_f44key_f43key_f42key_f41key_f40key_f39key_f38key_f37key_f36key_f35key_f34key_f33key_f32key_f31key_f30key_f29key_f28key_f27key_f26key_f25key_f24key_f23key_f22key_f21key_f20key_f19key_f18key_f17key_f16key_f15key_f14key_f13key_f12key_f11req_for_inputkey_sundokey_ssuspendkey_ssavekey_srsumekey_srightkey_sreplacekey_sredokey_sprintkey_spreviouskey_soptionskey_snextkey_smovekey_smessagekey_sleftkey_sickey_shomekey_shelpkey_sfindkey_sexitkey_seolkey_sendkey_selectkey_sdlkey_sdckey_screatekey_scopykey_scommandkey_scancelkey_sbegkey_undokey_suspendkey_savekey_resumekey_restartkey_replacekey_refreshkey_referencekey_redokey_printkey_previouskey_optionskey_openkey_nextkey_movekey_messagekey_markkey_helpkey_findkey_exitkey_enterkey_endkey_createkey_copykey_commandkey_closekey_cancelkey_beglabel_offlabel_onena_acsxon_characterxoff_characterexit_am_modeenter_am_modeexit_xon_modeenter_xon_modekey_btabplab_normacs_charschar_paddingprtr_nonkey_c3key_c1key_b2key_a3key_a1init_progup_half_lineunderline_charto_status_linetabset_windowset_tabset_attributesscroll_reversescroll_forwardsave_cursorrow_addressrestore_cursorreset_filereset_3stringreset_2stringreset_1stringrepeat_charprtr_onprtr_offprint_screenpkey_xmitpkey_localpkey_keyparm_up_cursorparm_rindexparm_right_cursorparm_left_cursorparm_insert_lineparm_indexparm_ichparm_down_cursorparm_delete_lineparm_dchpad_charnewlinemeta_onmeta_offlab_f9lab_f8lab_f7lab_f6lab_f5lab_f4lab_f3lab_f2lab_f10lab_f1lab_f0keypad_xmitkeypad_localkey_upkey_stabkey_srkey_sfkey_rightkey_ppagekey_npagekey_llkey_leftkey_ilkey_ickey_homekey_f9key_f8key_f7key_f6key_f5key_f4key_f3key_f2key_f10key_f1key_f0key_eoskey_eolkey_eickey_downkey_dlkey_dckey_ctabkey_clearkey_catabkey_backspaceinsert_paddinginsert_lineinsert_characterinit_fileinit_3stringinit_2stringinit_1stringfrom_status_lineform_feedflash_screenexit_underline_modeexit_standout_modeexit_insert_modeexit_delete_modeexit_ca_modeexit_attribute_modeexit_alt_charset_modeerase_charsenter_underline_modeenter_standout_modeenter_reverse_modeenter_protected_modeenter_secure_modeenter_insert_modeenter_dim_modeenter_delete_modeenter_ca_modeenter_bold_modeenter_blink_modeenter_alt_charset_modedown_half_linedis_status_linedelete_linedelete_charactercursor_visiblecursor_upcursor_to_llcursor_rightcursor_normalcursor_mem_addresscursor_leftcursor_invisiblecursor_homecursor_downcursor_addresscommand_charactercolumn_addressclr_eosclr_eolclear_screenclear_all_tabschange_scroll_regioncarriage_returnbellback_tabcX`X4]XZXWXTXQXNXKXHXEXBX?XV;V8V5V2V/V,V)V&V#V VVVVVVV VVVVUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU~U{UxUuUrUoUlUiUfUcU`U]UZUWUTUQUNUKUHUEUBU?U/;/8/5/2///,/)/&/#/0U-U*U'U$U!UUUUUUU U UUUUTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT|TyTvTsTpTmTjTgTdT`UaT^T[TXTUTRTOTLTITFTCT@T=T:T7T4T1T.T+TY#(T%T"TTTTTTT(WSLSrSlkzkkkinlmumlkobcS8S7S6S5S4S3S2S1YZYzYyYxYwYvZzXyMTs3s2s1s0cidvxlABAFGmRQMiKmZyZxZwZvZuZtZsZrZqZpZoZnZmZlZkZjZiZhZgZfZeZdZcZbZaZZZYZXZWZVZUZTZSZRZQZPZOZNZMZLZKZJZIZHZGZFZEZDZCZBZASbSfspIpIcWAPAfhPUTOQDDIHUWGCWRCDKSCLfMRMLMCcbFrFqFpFoFnFmFlFkFjFiFhFgFfFeFdFcFbFaFZFYFXFWFVFUFTFSFRFQFPFOFNFMFLFKFJFIFHFGFFFEFDFCFBFAF9F8F7F6F5F4F3F2F1RF!3!2!1%j%i%h%g%f%e%d%c%b%a#4#3#2#1*0*9*8*7*6*5*4*3*2*1&0&9&8&7&6&5&4&3&2&1%0%9%8%7%6%5%4%3%2%1@0@9@8@7@6@5@4@3@2@1LFLOeAXNXFRASARXSXkBpnacrPpOK5K4K2K3K1iPtstawistsasfcvr3r2r1rppopfpspxplpkUPSRRILEALSFICDODLDCpcnwmmmol9l8l7l6l5l4l3l2lal1l0kskekukTkRkFkrkPkNkHklkAkIkhk9k8k7k6k5k4k3k2k;k1k0kSkEkMkdkLkDktkCkakbalici3isi1fsvbueseeitemeaeecussomrmpmkimmhdmtimdmbasdsdcvsupndveCMlevihodocmCCchcdceclctcsblbtU$SEj]S蚴_jSj_EEE]SEPjd_ jz_Pd_jSjJ_ =4>,th@j,P ? D]؉]ÐUSku1= kt@< kuÅtkKu]]ÐUS,k=,ktЃ;uh Y_]]ÐU=juj]ÐUEtPܪ_]USEuP貮_ÃujЉ؋]]ÐUUju`Zj]ÐUUR]Virtual memory exceeded in `new' Uj"h0Zj϶_j耦_S\$̀}أj[Ð[ÐSV\$̀}أj[Ð[ÐS\$L$ T$̀}أj[Ð[ÐS[\$L$ ̀}أj[Ð[/lib/ld.so: can't load dynamic linker '/lib/ld.so' statically linked 8UWVSl$L\$P=kD$D bhR[t[|$][ ft8t@8u+PSj j*D$Pj hZ񐐐h8kh kT$\RSD$ PPD$\ЋT$,RT$,R &|$[+jD$PjM j[^_]8ÃfT$fur|$fD$f%fD$f%?fT$f fD$l$ÐUWVSl$|$19v WUT$RЃ C9w[^_]Ðlibc.so.4DLL Jump 4.5pl26[%s]ENTER to continue Show list: %d: '%s' End of listCommand (use ? for help): contentscontents%d.%d.%d.%d.itemcontentscontentscontentscontentscontentscontents.hc.h.menu.item.paaaaa %d%% of %s %s/docs/%sr%s%cdefault%cMenu.datr .item %s %s%s %s@{@[No other references found Search term: %s Are you sure you want a printoutcontents%s%cdocs%c%srwPrinting....menu%s/default/Menu.datr %s %s . %d %sPrinting...%s/docs/%sr%s%s%s%s- - %c%s%c%s%c Eon/Eiffel %s%s%d %s %slinesdevice/fileform feedbold onbold off+c1c=cGcOc%s/default/printer.cfgr/tmp/X%x%d%dversion%s%cdefault%cvdoc.hlpr[%s]String overrun when concatenating. String overrun when concatenating. [%s]ENTER to continue Show list: %d: '%s' End of listrNo permissions to read[%s]ENTER to continue Reading file...rCan't open ''. %d%% shown. Interrupt! [%s]ENTER to continue <^q^j ~@to continuedOperating system error numberdNo file access permissionse Continue? ~No ~Yes ~?Help ]``_j,,?``\kkay26_bufptr_s+A `O`?A``)`Wq `q`O`ܐX`ȈH`ȇ8`3`` `!``T`9``D``OY `eon3122/default000755 000000 000001 00000000000 05710535124 013633 5ustar00rootother000000 000000 eon3122/default/old000755 000000 000001 00000000000 05710535107 014412 5ustar00rootother000000 000000 eon3122/default/Menu.dat000644 000000 000001 00000003353 05710535112 015311 0ustar00rootother000000 000000 1 1 0001overview ABOUT EIFFEL 101 1.1 0038overview ABOUT EON/EIFFEL classes c++ 102 1.2 0064overview ABOUT THIS MANUAL 2 2 0001system THE EON/EIFFEL SYSTEM 201 2.1 0015system THE EON/EIFFEL DATABASE database 202 2.2 0027system CLASSES class classes 203 2.3 0053system CLUSTERS classes 204 2.4 0066system AST FILES database class classes .t .e 205 2.5 0089system DEFINING A SYSTEM classes 206 2.6 0103system THE EXECUTIVE COMPILER classes 207 2.7 0115system THE BROWSER database classes 208 2.8 0133system THE DOCUMENTING TOOLS class 3 3 0001user CREATING A SYSTEM 4 4 0001refer USER MANUAL 401 4.1 0003refer CLASSES class classes .e 502 5.2 0033refer ROOT CLASSES classes 503 5.3 0037refer CLUSTERS class classes .t .e c++ 504 5.4 0166refer CLUSTER COMMENTS class 505 5.5 0201refer DATABASE database class classes 50501 5.5.1 0225refer RELOCATING THE DATABASE database 50502 5.5.2 0251refer DETERMING IF THE DATABASE HAS BECOME CORRUPTED database class 505 5.5 0263refer DEBUGGING EIFFEL CODE class 50602 5.6.2 0375refer RUNTIME CHECKING OF NULL ENTITIES class 507 5.7 0406refer EON EXECUTIVE database class classes .t c++ 50701 5.7.1 0451refer COMMAND LINE OPTIONS database class classes c++ 50702 5.7.2 0556refer CONFIGURATION database class c++ 508 5.8 0595refer SYSTEM DESCRIPTION FILES class classes c++ 509 5.9 0693refer NAMING CONVENTIONS 50901 5.9.1 0698refer CONVENTIONS USED IN THE LANGUAGE class classes 50902 5.9.2 0763refer CONVENTIONS USED IN THE DOCUMENTATION c++ 6 6 0001app-a ENVIRONMENT VARIABLES 606 6.6 0004app-a ENVIRONMENT VARIABLES TO CONTROL COMPILATION database 602 6.2 0053app-a ENVIRONMENT VARIABLES TO CONTROL SYSTEM EXECUTION 7 7 0001app-c DOCUMENT VIEW eon3122/default/bcc-win.cfg000644 000000 000001 00000002451 05710535112 015714 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- C compiler = bcc C++ compiler = bcc -- Use to compiler C++ programs Linker = bcc -- Add the following for debugging -- -v -W -N Compiler flags = -DMSDOS -D_BCC_ -DBORLAND_SIGNAL_BUG -Pcc -w-ccc -w-winl -w-par -w-rch -ml -w-hid -V -DWIN32 -W ec2 flags = -EI -Em Manifests = -D_EON_ -I. -- Add the following for debugging -- -v Linker flags = -W -lc -ml -lx -- Use tcc to perform linking so pass on flags Library flags = /C -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc Header file extension = h Object extension = obj Library extension = lib Library prefix = -- -- Configure the command lines for calling the various C compiler stages -- Executable extension = .exe Response file = Yes CC response = $(C++ compiler) @$(TEMPFILE) CC command = $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS) \ #( ,-I${INCLUDE FLAGS}) -o$(TARGET) -c $(SOURCE) Archiver response = tlib /C @$(TEMPFILE) Archiver command = \ $(CLUSTER PATH)\$(CLUSTER).lib -+#( &%N-+,${OBJECT FILES}.obj) Linker response = $(Linker) @$(TEMPFILE) Linker command = $(Linker flags) -e$(SYSTEM NAME).exe \ -L$(EON)/bibt bibt.lib $(LIBRARIES) #( ,${CLUSTER LIST}) $(ROOT MODULE) eon3122/default/bcc.cfg000644 000000 000001 00000002402 05710535112 015115 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- C compiler = bcc C++ compiler = bcc Linker = bcc -- Add the following for debugging -- -v -W -N Compiler flags = -DMSDOS -D_BCC_ -DBORLAND_SIGNAL_BUG -Pcc -w-ccc -w-winl -w-par -w-rch -ml -w-hid -V -DUSE_BOOL ec2 flags = -EI -Em Manifests = -D_EON_ -I. -- Add the following for debugging -- -v Linker flags = -ml -lx -- Use bcc to perform linking so pass on flags Library flags = /C -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc Header file extension = h Object extension = obj Library extension = lib Library prefix = -- -- Configure the command lines for calling the various C compiler stages -- Executable extension = .exe Response file = Yes CC response = $(C++ compiler) @$(TEMPFILE) CC command = $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS) \ #( ,-I${INCLUDE FLAGS}) -o$(TARGET) -c $(SOURCE) Archiver response = tlib /C @$(TEMPFILE) Archiver command = \ $(CLUSTER PATH)\$(CLUSTER).lib -+#( &%N-+,${OBJECT FILES}.obj) Linker response = $(Linker) @$(TEMPFILE) Linker command = $(Linker flags) -e$(SYSTEM NAME).exe \ -L$(EON)/bibt bibt.lib $(LIBRARIES) #( ,${CLUSTER LIST}) $(ROOT MODULE) eon3122/default/djgpp.bat000644 000000 000001 00000000354 05710535112 015505 0ustar00rootother000000 000000 rem Setup for DJ's port of the Gnu C compiler to MSDOS rem Only works with version 1.12 rem set DJGPP=C:/DJGPP/DJGPP.ENV set TMPDIR=C:/tmp set GO32TMP=c:/tmp set GO32=c:/djgpp/drivers/vga.grd gw 1024 gh 768 set PATH=C:\DJGPP\BIN;%PATH% eon3122/default/djgpp.cfg000644 000000 000001 00000002356 05710535113 015503 0ustar00rootother000000 000000 -- -- DJGPP configuration file. -- -- This is for pre 1.12 versions of DJGPP C compiler = gcc C++ compiler = gcc Linker = gcc Compiler flags = -DMSDOS -fstrength-reduce -fpcc-struct-return -D_DJGPP_ ec2 flags = -Ei Manifests = -D_EON_ -I. -DNEEDS_BOOL -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc -- cc not CC Header file extension = h Object extension = o Library extension = a Library prefix = lib -- -- Configure the command lines for calling the various C compiler stages -- Executable extension = .exe Response file = Yes Linker output name = $(SYSTEM NAME).out CC response = $(C++ compiler) @$(TEMPFILE) CC command = $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS)%N \ #( ,-I${INCLUDE FLAGS})%N -c $(SOURCE) -o $(TARGET) Archiver response = ar rc @$(TEMPFILE) Archiver command = $(CLUSTER PATH)/lib$(CLUSTER).a #( ,${OBJECT FILES}.o) Ranlib command = ranlib $(CLUSTER PATH)\lib$(CLUSTER).a Linker response = $(Linker) @$(TEMPFILE) Linker command = $(Linker flags) $(ROOT MODULE) #( ,${CLUSTER LIST}) \ $(Libraries) -L$(EON)/bibt -lbibt -o $(SYSTEM NAME).out Post link command = aout2exe $(SYSTEM NAME).out eon3122/default/djgpp.doc000644 000000 000001 00000010273 05710535112 015505 0ustar00rootother000000 000000 INSTALLING DJGPP C COMPILER Many Eiffel users are not going to be interested in setting up C compilers. The following is offered as a quick guide to installing DJ's port of the Gnu C/C++ compiler for MSDOS. If you know what you are doing, you won't need all this but ** PLEASE READ POINT NUMBER SEVEN ** This has been tried on MSDOS 6.2 and MSDOS 5. Firstly you will need to get the compiler, probably from wherever you rot the Eon/Eiffel package. The DJGPP distribution is split in to several files. As a new release comes out the version number is incremented so XXX represents the current release. You will require the following files: djeoeXXX.zip djdevXXX.zip gccXXXbn.zip gasXXXbn.zip bnuXXXbn.zip gppXXX.zip If you are not really interest in C, tru to get these versions as they are known to work: djeoe112.zip djdev112.zip gcc260bn.zip gas23bn.zip bnu24bn.zip gpp260.zip The version number 112 is DJ's vversion number. 260 is for the C compiler. There are also maintenance releases. Get these if you have the time. The current ones are called dj112m1.zip, dj112m2.zip. ************* WARNING!! ************* **** DO NOT USE gcc261 or gcc262 **** * They have bugs which will prevent * ****** Eon/Eiffel from working ****** You should really read the readme files in DJ's package, however here is a brief list of things to do in order to get you started. (1) Your CONFIG.SYS file You should have two lines for the number of file handles and the size of the environment. Make sure the values exceed the examples below. FILES=50 SHELL=C:\COMMAND.COM /E:1000 /P You will also need an extended memory manager. If you are going to compile things in a Windows MSDOS screen you will already have one. If you are running in normal MSDOS, make sure you have a memory manager loaded. The standard one that comes with MSDOS is EMM386. If you have 8mb of memory, try a line like: DEVICE=C:\DOS\EMM386.SYS 4096 if you only have 4mb, try: DEVICE=C:\DOS\EMM386.SYS 2048 Without a memory manager things will run very, very slowly. My CONFIG.SYS file looks like this (after I have taken all the rubbish out): LASTDRIVE=Z DEVICE=C:\DOS\SETVER.EXE DEVICE=C:\WINDOWS\HIMEM.SYS DEVICE=C:\DOS\EMM386.exe 4096 DOS=HIGH COUNTRY=044,,C:\DOS\COUNTRY.SYS DEVICE=C:\DOS\DISPLAY.SYS CON=(EGA,,1) FILES=50 DEVICE=C:\WINDOWS\SMARTDRV.EXE /DOUBLE_BUFFER STACKS=9,256 This is from an MSDOS 6.2 with EMM386 added, but the same works with MSDOS 5. (2) Your autoexec.bat file. A setup file for DJGPP is included in \EON\DEFAULT and is called DJGPP.BAT. This will only work with version 1.12 of DJGPP. You can either add the lines to your autoexec.bat file, call it directly or run it from DOS. For reference, my AUTOEXEC.BAT FILE looks something like this: C:\WINDOWS\SMARTDRV.EXE /L /X @ECHO OFF PROMPT $p$g PATH C:\WINDOWS;C:\DOS;C:\BIN SET TEMP=C:\DOS MODE CON CODEPAGE PREPARE=((437) C:\DOS\EGA.CPI) MODE CON CODEPAGE SELECT=437 KEYB UK,,C:\DOS\KEYBOARD.SYS DJGPP's startup file looks like this: set DJGPP=C:/DJGPP/DJGPP.ENV set TMPDIR=C:/TMP set GO32TMP=c:/TMP set GO32=c:/djgpp/drivers/vga.grd gw 1024 gh 768 set PATH=C:\DJGPP\BIN;%PATH% There's a fair bit to play with here. It also assumes you have a VGA video card. (3) Create the temporary file C:\TMP (4) Create a directory C:\DJGPP and change into it. If you already have an older version, archive it and delete it. (5) In C:\DJGPP, unzip all the distribution files listed at the beginging use either PKUZIP.EXE, for example: C:\DJGPP> pkunzip -d -o djeoe112.zip or UNZIP.EXE C:\DJGPP> unzip -o djeoe112.zip (6) If you have the maintainence releases, unpack them, in order, and run the install batch file. These will be called 112M1.BAT and 112M2.BAT. These will install some source code which you may not want. You can tidy it up if you want, you will not need the directories, "src", "orig" or "tests". (7) There is an error in one of the C++ header files. Edit \djgpp\include\signal.h, on or about line 91 you will find the line: typedef void (*SignalHandler)() it should read: typedef void (*SignalHandler)(int) eon3122/default/gcc25.cfg000644 000000 000001 00000002067 05710535112 015300 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- -- This is for those with gnu C but not the gnu utilities C compiler = gcc C++ compiler = gcc Compiler flags = -g -fstrength-reduce -fpcc-struct-return -DNEEDS_BOOL ec2 flags = -Ei -Em Manifests = -D_EON_ -I. -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc Header file extension = H Object extension = o Library extension = a Library prefix = lib -- -- Configure the command lines for calling the various C compiler stages -- Response file = No CC command = $(C++ compiler) $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS) \ #( ,-I${INCLUDE FLAGS}) -c $(SOURCE) -o $(TARGET) Archiver command = ar cr $(CLUSTER PATH)/lib$(CLUSTER).a #( ,${OBJECT FILES}.o) -- -- Some versions of the Unix linker require libraries to be ranlib'ed -- -- Ranlib command = $(Ranlib) lib$(CLUSTER).a Linker command = gcc $(Linker flags) $(ROOT MODULE) \ #( ,${CLUSTER LIST}) \ $(Libraries) -L$(EON)/bibt -lbibt -o $(SYSTEM NAME) eon3122/default/gcc26.cfg000644 000000 000001 00000002052 05710535113 015274 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- -- This is for those with gnu C but not the gnu utilities C compiler = gcc C++ compiler = gcc Compiler flags = -g -fstrength-reduce -fpcc-struct-return ec2 flags = -Ei -Em Manifests = -D_EON_ -I. -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc Header file extension = H Object extension = o Library extension = a Library prefix = lib -- -- Configure the command lines for calling the various C compiler stages -- Response file = No CC command = $(C++ compiler) $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS) \ #( ,-I${INCLUDE FLAGS}) -c $(SOURCE) -o $(TARGET) Archiver command = ar cr $(CLUSTER PATH)/lib$(CLUSTER).a #( ,${OBJECT FILES}.o) -- -- Some versions of the Unix linker require libraries to be ranlib'ed -- -- Ranlib command = $(Ranlib) lib$(CLUSTER).a Linker command = gcc $(Linker flags) $(ROOT MODULE) \ #( ,${CLUSTER LIST}) \ $(Libraries) -L$(EON)/bibt -lbibt -o $(SYSTEM NAME) eon3122/default/gnu25.cfg000644 000000 000001 00000002061 05710535113 015330 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- -- This is for those with gnu C and the gnu utilities C compiler = gcc C++ compiler = gcc Compiler flags = -fstrength-reduce -fpcc-struct-return -DNEEDS_BOOL ec2 flags = -Ei -Em Manifests = -D_EON_ -I. -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc Header file extension = H Object extension = o Library extension = a Library prefix = lib -- -- Configure the command lines for calling the various C compiler stages -- Response file = No CC command = $(C++ compiler) $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS) \ #( ,-I${INCLUDE FLAGS}) -c $(SOURCE) -o $(TARGET) Archiver command = ar crs $(CLUSTER PATH)/lib$(CLUSTER).a #( ,${OBJECT FILES}.o) -- -- Some versions of the Unix linker require libraries to be ranlib'ed -- -- Ranlib command = $(Ranlib) lib$(CLUSTER).a Linker command = gcc $(Linker flags) $(ROOT MODULE) \ #( ,${CLUSTER LIST}) \ $(Libraries) -L$(EON)/bibt -lbibt -o $(SYSTEM NAME) eon3122/default/gnu26.cfg000644 000000 000001 00000002046 05710535113 015334 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- -- This is for those with gnu C and the gnu utilities C compiler = gcc C++ compiler = gcc Compiler flags = -g -fstrength-reduce -fpcc-struct-return ec2 flags = -Ei -Em Manifests = -D_EON_ -I. -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc Header file extension = H Object extension = o Library extension = a Library prefix = lib -- -- Configure the command lines for calling the various C compiler stages -- Response file = No CC command = $(C++ compiler) $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS) \ #( ,-I${INCLUDE FLAGS}) -c $(SOURCE) -o $(TARGET) Archiver command = ar cr $(CLUSTER PATH)/lib$(CLUSTER).a #( ,${OBJECT FILES}.o) -- -- Some versions of the Unix linker require libraries to be ranlib'ed -- -- Ranlib command = $(Ranlib) lib$(CLUSTER).a Linker command = gcc $(Linker flags) $(ROOT MODULE) \ #( ,${CLUSTER LIST}) \ $(Libraries) -L$(EON)/bibt -lbibt -o $(SYSTEM NAME) eon3122/default/linux.txt000644 000000 000001 00000001165 05710535113 015613 0ustar00rootother000000 000000 Linux uses the Gnu C compiler and utilities Check what version of the C++ compiler you have (gcc -v), if it is 2.5.? link gnu25.cfg to linux.cfg. If it 2.6.? link gnu26.cfg to linux.cfg. Don't use gcc25.cfg, this is for Unix systems with the gnu compiler but not the gnu binutils. Warning!! Version 2.6.1 and 2.6.2 have a bug that makes them unsuitable for Eon/Eiffel. Don't use them. If you have upgraded already but still have the old version in /usr/local/lib modify these lines in your C compiler: C compiler = gcc -V 2.6.0 C++ compiler = gcc -V 2.6.0 but, of course, substitute whatever version you have for 2.6.0. eon3122/default/README000644 000000 000001 00000000212 05710535113 014563 0ustar00rootother000000 000000 This directory contains configuration files for older release of the supported compilers. Read the headers in each for more information. eon3122/default/printer.cfg000644 000000 000001 00000000213 05710535113 016050 0ustar00rootother000000 000000 -- -- Basic printer configuration file for the document viewer. -- Lines = 66 Device/file = /tmp/X Form feed = ^L Bold_on = Bold_off = eon3122/default/tcc.cfg000644 000000 000001 00000002251 05710535113 015142 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- C compiler = tcc C++ compiler = tcc Linker = tcc Compiler flags = -DMSDOS -D_TCC_ -DBORLAND_SIGNAL_BUG -Pcc -w-ccc -w-winl -w-par -w-rch -ml -w-hid ec2 flags = -EI -Em Manifests = -D_EON_ -I. -DNEEDS_BOOL Linker flags = -ml -lx -- Use tcc to perform linking so pass on flags Library flags = /C -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc Header file extension = h Object extension = obj Library extension = lib Library prefix = -- -- Configure the command lines for calling the various C compiler stages -- Executable extension = .exe Response file = Yes CC response = $(C++ compiler) @$(TEMPFILE) CC command = $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS) \ #( ,-I${INCLUDE FLAGS}) -o$(TARGET) -c $(SOURCE) Archiver response = tlib /C @$(TEMPFILE) Archiver command = \ $(CLUSTER PATH)\$(CLUSTER).lib -+#( &%N-+,${OBJECT FILES}.obj) Linker response = $(Linker) @$(TEMPFILE) Linker command = $(Linker flags) -e$(SYSTEM NAME).exe \ -L$(EON)/bibt bibt.lib $(LIBRARIES) #( ,${CLUSTER LIST}) $(ROOT MODULE) eon3122/default/Makefile000644 000000 000001 00000000325 05710535113 015350 0ustar00rootother000000 000000 include $(EONROOT)/config/makedefs.h all: stest dtest bool stest: stest.o $(CC) stest.o -o stest dtest: dtest.o $(CC) dtest.o -o dtest bool: bool.o $(CC) bool.o -o bool clean: rm -f *.o stest dtest bool eon3122/default/bool.cc000644 000000 000001 00000000442 05710535113 015152 0ustar00rootother000000 000000 #include /* * If your c++ compiler does not understand built in `bool' types * of true and false you will need to define NEEDS_BOOL * in the bibt/ert.H file. */ #ifdef NEEDS_BOOL enum bool { false=0, true=1 }; #endif main() { printf ( "BOOL = %d %d\n", true, false); } eon3122/default/dtest.cc000644 000000 000001 00000007747 05710535114 015362 0ustar00rootother000000 000000 /* * --- EON SOFTWARE --- * * 19 Stapleton Road. Headington. Oxford. OX3 7LX UK. * Phone or Fax: +44 (0)865 741452 * eMail: eonsw@eonsw.demon.co.uk * * Eon/Eiffel (c) 1994 Eon Software * This is the unpublished proprietary source code of Eon Software * * See the accompanying NOTICE file for details. */ #include #include class GENERAL { public: int id; GENERAL() { c_object_address = (void*)this; c_ob = (void*)this; id = 10; class_id = id; } int a; int b; void *c_object_address; void *c_ob; int class_id; }; class ANY : public virtual GENERAL { public: int id; ANY() { c_object_address = (void*)this; c_ob = (void*)this; id = 1; class_id = id; } void *c_ob; }; class SUPPLIER : public virtual ANY { public: char *identifer; int id; SUPPLIER () { id = 5; class_id = id; } virtual set(char *s) { identifer = s; } virtual int show () { return 100; } }; class SHAPE : public virtual ANY { public: SHAPE() { c_object_address = (void*)this; id = 2; class_id = id; c_ob = (void*)this; s = new SUPPLIER; s->set ( "shape"); } int id; virtual int sides () { return -1; }; void *c_ob; virtual info() { printf ( "INFO: ID=%d Class id %d c_ob=%x\n", id, class_id, c_object_address); } virtual char *name () { return "SHAPE"; } virtual char *basename () { return "SHAPE"; } SUPPLIER *s; /* void * pcvt( int n) { SHAPE *sh; case 1: break; case 2: sh = (SHAPE *) a; break; } ret = (void *) sh; return ret; } */ }; class POLYGON : public virtual SHAPE { public: POLYGON () { id = 6; class_id = id; c_object_address = (void*)this; c_ob = (void*)this; } }; class SQUARE : public virtual POLYGON { public: ANY *a; SQUARE () { id = 3; class_id = id; c_object_address = (void*)this; c_ob = (void*)this; s = new SUPPLIER; s->set ( "shape"); } int id; void *c_ob; virtual int sides () { return 4; }; virtual char *name () { return "SQUARE"; } SUPPLIER *s; void * pcvt( int n) { SHAPE *sh; switch ( n) { case 1: break; case 2: sh = (SHAPE *) this; break; } return (void *) sh; } }; class ARRAY : public virtual ANY { public: int id; ARRAY () { c_object_address = (void*)this; c_ob = (void*)this; id = 4; class_id = id; } void *addr; void *c_ob; push ( ANY *a) { addr = a; } ANY *pop () { return (ANY *) addr; } virtual put ( ANY *x) { push ( x); } virtual ANY *item () { ANY *a; a = pop(); return a; } }; void * cvt( ANY *a); main() { SQUARE *square; SQUARE *new_square; ARRAY *store; SHAPE *shape; square = new SQUARE; store = new ARRAY; if ( strcmp ( "SHAPE", square->basename())) { printf ( "Failed!\n"); exit ( 1); } if ( strcmp ( "SQUARE", square->name())) { printf ( "Failed!\n"); exit ( 1); } if ( square->sides() != 4) { printf ( "Failed!\n"); exit ( 1); } shape = square; if ( strcmp ( "SQUARE", square->name())) { printf ( "Failed!\n"); exit ( 1); } if ( strcmp ( "SQUARE", shape->name())) { printf ( "Failed!\n"); exit ( 1); } if ( square->SHAPE::sides() != -1) { printf ( "Failed!\n"); exit ( 1); } if ( square->sides() != 4) { printf ( "Failed!\n"); exit ( 1); } store->put ( square); shape = (SHAPE*) cvt ( store->item()); if ( strcmp ( "SQUARE", ((SHAPE*) cvt ( store->item()))->name())) { printf ( "Failed!\n"); exit ( 1); } if ( 4 != ((SHAPE*) cvt ( store->item()))->sides()) { printf ( "Failed!\n"); exit ( 1); } if ( 100 != ((SHAPE*) cvt ( store->item()))->s->show()) { printf ( "Failed!\n"); exit ( 1); } return 0; } void * cvt( ANY *a) { int aid = a->class_id; switch ( aid) { case 1: break; case 2: /* SHAPE */ SHAPE _shape; break; case 3: /* SQUARE */ return ((SQUARE *)a->c_object_address)->pcvt ( 2); break; case 4: break; case 5: break; } return (void *) 0; } eon3122/default/stest.cc000644 000000 000001 00000005757 05710535114 015400 0ustar00rootother000000 000000 /* * --- EON SOFTWARE --- * * 19 Stapleton Road. Headington. Oxford. OX3 7LX UK. * Phone or Fax: +44 (0)865 741452 * eMail: eonsw@eonsw.demon.co.uk * * Eon/Eiffel (c) 1994 Eon Software * This is the unpublished proprietary source code of Eon Software * * See the accompanying NOTICE file for details. */ #include #include #include #define HAS_LONGJMP /* longjmp implemented */ #define CAN_HACK_C_TO_CPP /* Pass current object as first argument */ #ifdef NO_SAFE_SIGNALS #define sigset signal #endif #ifdef HAS_LONGJMP #include #endif int okay = 0; extern "C" { #ifdef HAS_LONGJMP struct { jmp_buf jmpenv; void *addr; } Env; #endif struct { char *mess; void (*isr)(...); int mode; /* 1:Continue 2:Exit */ } Signals[3] = { "Bad signal number", 0, 1, "Hangup", 0, 1, "Keyboard", 0, 1, }; void global_error_handler(int n) { printf ( "INTERRUPT (%s) %x\n", Signals[n].mess, n); if ( n == SIGINT) { printf ( "Received SIGINT in C scope okay\n"); okay++; } #ifdef CAN_HACK_C_TO_CPP Signals[n].isr(Env.addr, n); #else Signals[n].isr(n); #endif #ifdef NO_SAFE_SIGNALS signal ( SIGINT, global_error_handler); #endif #ifdef HAS_LONGJMP if ( Signals[n].mode) { sigset ( SIGINT, global_error_handler); longjmp ( Env.jmpenv, 1); } #else printf ( "Terminating\n"); exit ( 1); #endif } } class X { public: void test() { #ifdef HAS_LONGJMP if ( setjmp ( Env.jmpenv)) goto _rescue; Env.addr = this; printf ( "Class address: %x\n", this); #endif _restart: Signals[SIGINT].isr = (void(*)(...)) &xisr; Signals[SIGINT].mode = Signals[SIGINT].mode ? 0 : 1; printf ( "Mode: %d\n", Signals[SIGINT].mode); printf ( "Hit DEL/^C now, ENTER to end "); fflush ( stdout); if ( getchar () != '\n') { if ( Signals[SIGINT].mode == 1) printf ( "*** SHOULDN'T BE HERE 0 longjmp() failed ***\n"); printf ( "Try again\n"); goto _restart; } return; _rescue: printf ( "RESCUE\n"); goto _restart; } void xisr(int n) { printf ( "C++ INTERRUPT (%s) %x\n", Signals[n].mess, n); if ( n == SIGINT) { printf ( "Received SIGINT n C++ scope okay\n"); okay++; } printf ( "\n\n"); if ( okay != 2) printf ( "**** FAILED ****\n"); else printf ( "Passed test okay\n"); okay = 0; } }; int main() { X *x; printf ( "\nThis is a test program to establish if a C++ compiler\n"); printf ( " passes a class address as it's first argument and picks\n"); printf ( " up the signal number correctly.\n\n"); printf ( "If it doesn't EON/Eiffel exceptions will not work\n"); printf ( " for signal() style interrupts.\n"); printf ( "To test, hit the keyboard interrupt a few times and make\n"); printf ( " sure that there are no error messages.\n"); printf ( "\n\n\n"); sigset ( SIGINT, global_error_handler); x = new X; /*signal ( SIGINT, (void (*)(int)) I);*/ x->test (); return 0; } eon3122/default/emx.cfg000644 000000 000001 00000002421 05710535114 015162 0ustar00rootother000000 000000 -- -- C Compiler configuration file. -- C compiler = gcc C++ compiler = gcc Linker = gcc Archiver = ar Archiver flags = rc Compiler flags = -DMSDOS -fstrength-reduce -fpcc-struct-return -D_DJGPP_ ec2 flags = -Ei -- -- Libraries you always want -- Library search = -L. Libraries = -- -- Different C++ compilers require different extensions for various files -- C++ extension = cc -- cc not CC Header file extension = h Object extension = o Library extension = a Library prefix = lib -- -- Configure the command lines for calling the various C compiler stages -- Executable extension = .exe Response file = Yes Response file seperator = %N Linker output name = $(SYSTEM NAME).out CC response = $(C++ compiler) @$(TEMPFILE) CC command = $(MANIFESTS) $(Compiler flags) $(DEBUG KEYS)%N \ #( ,-I${INCLUDE FLAGS})%N -c $(SOURCE) -o $(TARGET) Archiver response = $(Archiver) $(Archiver flags) @$(TEMPFILE) Archiver command = $(CLUSTER PATH)/lib$(CLUSTER).a #( ,${OBJECT FILES}.o) Ranlib commmand = $(Ranlib) lib$(CLUSTER).a Linker response = $(Linker) @$(TEMPFILE) Linker command = $(Linker flags) $(ROOT MODULE) \ #( ,${CLUSTER LIST}) $(Libraries) -o $(SYSTEM NAME).out Post link command = aout2exe $(SYSTEM NAME).out eon3122/default/vdoc.hlp000644 000000 000001 00000001551 05710535114 015353 0ustar00rootother000000 000000 Available Keys ( Unless indicated commands are not case sensitive) ENTER ................ when the cursor is over a searchable word, pop up the picklist 'm' .................. Return to contents page F10 .................. Return to contents page. If contents are already displayed, exit PAGE UP or 'F' ....... Next page PAGE DOWN or 'B' ..... Previous page 'f' .................. Forward half a page 'b' .................. Back half a page CURSOR UP or 'l' ..... Next line CURSOR DOWN or 'p' ... Previous line CURSOR LEFT or 'r'.... Move to last searchable word CURSOR RIGHT or 'v' .. Move to next searchable word 'p' .................. Print 'q' .................. Quit Words in green can be used as search terms. Words in bold white are just highlighted for clear reading Press ENTER to return to information screen eon3122/basic000755 000000 000001 00000000000 05710535122 013266 5ustar00rootother000000 000000 eon3122/basic/COMMENT000644 000000 000001 00000000337 05710535121 014374 0ustar00rootother000000 000000 Cluster: Intrinsic -- Basic class library -- Development only -- Incomplete Manifest: array.e comparable.e core.e file.e general.e in_stream.e integer.e io_stream.e numeric.e out_stream.e platform.e std_files.e string.e eon3122/basic/alias.dir000644 000000 000001 00000000152 05710535121 015133 0ustar00rootother000000 000000 EXCEPTIONS EXCEPT MSDOS STD_FILES STD_FILE IO_STREAM IO_STREA IN_STREAM IN_STREA OUT_STREAM OUT_STRE eon3122/basic/any.e000644 000000 000001 00000000074 05710535121 014302 0ustar00rootother000000 000000 class ANY inherit PLATFORM feature end -- class ANY eon3122/basic/core.e000644 000000 000001 00000003604 05710535121 014445 0ustar00rootother000000 000000 class CORE creation allocate feature { ANY} capacity: INTEGER -- size (in bytes) of memory area allocated to `Current' space: POINTER -- the area allocated allocate ( nb_bytes: INTEGER) is -- Allocate at least `nb_bytes' of memory require nb_bytes > 0 do if nb_bytes > capacity then release space := c_alloc ( nb_bytes) capacity := nb_bytes; end ensure capacity >= nb_bytes end -- allocate expand ( newsize: INTEGER) is -- increase size of area allocated, preserving contents -- only if `newsize' > `capacity' local tmp_space: CORE do if newsize > capacity then -- !!tmp_space !!tmp_space.allocate ( newsize) c_memcpy ( tmp_space.space, space, capacity) release space := tmp_space.space capacity := newsize end end -- expand release is -- return memory allocated to `Current' to memory manager -- depends upon garbage collection mode: if GC /= manual, -- this routine is a no-op do if space /= Void then core_free ( space) space := Void end capacity := 0 ensure capacity = 0 end -- release feature { NONE} c_alloc ( n: INTEGER): POINTER is -- get `n' bytes of space to store string in, -- return (C) pointer to that space, as an integer external "C" end -- c_alloc core_free ( sp: POINTER) is -- release any memory allocated to `Current' external "C" alias "c_free" end -- core_free c_memcpy ( tgt, src: POINTER; nb: INTEGER) is external "C" end -- c_memcpy invariant capacity > 0 implies space /= Void end -- class CORE eon3122/basic/except.e000644 000000 000001 00000020047 05710535122 015006 0ustar00rootother000000 000000 -- Facilities for controling exception handling class EXCEPTIONS feature show_except is -- Print a trace message when an exception occurs -- (This is not the default: see no_show_except.) external "C" alias "_ert_show_trace" end -- show_except no_show_except is -- Don't print a trace message when an exception occurs -- (This is not the default: see show_except.) external "C" alias "_ert_no_show_trace" end -- no_show_except assertion_violation:BOOLEAN is -- Was last exception due to a violated assertion or -- non-decreasing variant? external "C" alias "_ert_assertion_violation" end -- assertion_violation catch ( code:INTEGER) is -- Make sure that any exception of code `code' will be caught. -- This is the default. (See `continue', `ignore'.) do except_mode ( code, Caught) ensure status ( code) = Caught end -- catch Check_instruction :INTEGER is 105 -- See EXCEPT_CHECK_INSTRUCTION -- Exception code for violated check Class_invariant :INTEGER is 102 -- See EXCEPT_INVARIANT -- Exception code for violated class invariant class_name: STRING is -- Name of the class containing the routine which was the -- recipient of the oldest exceptions not leading to a retry. -- Is void initially and after a retry. external "C" alias "_ert_last_exception_name" end -- class_name continue(code:INTEGER) is -- Make sure that any exception of code `code' will cause -- exceution to resume after a call to `continue_action(code)' -- This is not the default. (See `catch', `ignore') require must_be_a_signal: is_signal(code) do except_mode ( code, Continued) ensure status(code) = Continued end -- continue continue_action(code:INTEGER) is do end developer_exception_name:STRING -- Name of last developer-raise exception (See `raise') exception:INTEGER is -- Code of last exception that occured external "C" alias "_ert_last_exception" end -- exception ignore(code:INTEGER) is -- Make sure that any exception of code `code' will br ignored -- This is not the default. (See `catch', `ignore') do except_mode ( code, Ignored) ensure status(code) = Ignored end -- ignore Incorrect_inspection_value:INTEGER is 112 -- See EXCEPT_INSPECTION_VALUE is_developer_exception_code(code:INTEGER):BOOLEAN is -- is `code' the code of a developer-defined exception (See `raise')? do if code < 0 then Result := true else Result := false end end -- is_developer_exception_code is_assertion_violation(code:INTEGER):BOOLEAN is -- is `code' the code of an exception resulting from the violation -- of an assertion (precondition,poscondition,invariant,check)? do if code >= Precondition and code <= Check_instruction then Result := true else Result := false end end -- is_assertion_violation is_signal(code:INTEGER):BOOLEAN is -- is `code' the code of an exception due to hardware -- or operating system? do if code > 0 and code < Precondition then Result := true else Result := false end end -- is_signal_code Loop_invariant:INTEGER is 103 -- See EXCEPT_LOOP_INVARIANT -- Exception code for violated loop invariant Loop_variant:INTEGER is 104 -- See EXCEPT_LOOP_VARIANT -- Exception code for non-decreased loop variant meaning(code:INTEGER):STRING is -- Nature of exception of code `code', expressed in plain English external "C" alias "_ert_except_mesg" end -- meaning message_on_failure is -- Print an Exception History Table in case of failure. -- (This is the default: see no_message_on_failure.) external "C" alias "_ert_show_trace_on_failure" end -- message_on_failure no_message_on_failure is -- Do not print an Exception History Table in case of failure. -- (This is not the default: see message_on_failure.) external "C" alias "_ert_no_show_trace_on_failure" end -- no_message_on_failure No_more_memory:INTEGER is 108 -- See EXCEPT_NO_MORE_MEMORY -- Exception code for failed memory allocation original_exception:INTEGER is -- Code of oldest exception not leading to a Retry external "C" alias "_ert_original_exception" end -- original_exception Postcondition:INTEGER is 101 -- See EXCEPT_POSTCONDITION -- Exception code for violated postcondition Precondition:INTEGER is 100 -- See EXCEPT_PRECONDITION -- Exception code for violated precondition Rescue_failure:INTEGER is 100 -- See EXCEPT_RESCUE_FAILED -- Exception code for violated precondition raise(code:INTEGER; name:STRING) is -- Raise a developer exception of `code' and name `name' require negative_code: code < 0 and code > Developer_5 do developer_exception_name := name raise_developer_exception ( code) end -- raise reset_all_default is -- Make sure that all exceptions will lead to their default handling external "C" alias "_ert_reset_all_default" end -- reset_all_default reset_default(code:INTEGER) is -- Make sure that exception of code `code' will lead -- to its default action. external "C" alias "_ert_reset_default" end -- reset_all_default Routine_failure:INTEGER is 106 -- See EXCEPT_ROUTINE_FAILURE -- Exception code for failed routine routine_name:STRING is -- Code of oldest exception not leading to a Retry external "C" alias "_ert_routine_name" end -- routine_name status(code:INTEGER):INTEGER is -- Status currently set for exception `code' (default: `Caught') external "C" alias "_ert_except_status" ensure Result = Caught or Result = Continued or Result = Ignored end -- status Ignored:INTEGER is 1 -- See EXCEPT_IGNORE Caught:INTEGER is 2 -- See EXCEPT_CATCH Continued:INTEGER is 3 -- See EXCEPT_CONTINUE -- Possible status for exception codes tag_name:STRING is -- Tag of last violated assertion external "C" alias "_ert_tag_name" end -- tag_name Void_assigned_to_expanded:INTEGER is 113 -- See EXCEPT_ASSIGNED_TO_EXPANDED -- Exception code for assignement of void value to expanded entity Void_target_call :INTEGER is 107 -- See EXCEPT_VOID_TARGET_CALL -- Exception code for feature called on void reference void_call_target:STRING is -- Name of feature that was called on a void reference external "C" alias "_ert_void_call_target" end -- void_call_target call_to_deferred :INTEGER is 109 -- See EXCEPT_CALL_TO_DEFERRED Bad_signal :INTEGER is 110 -- See EXCEPT_BAD_SIGNAL -- An unexpected signal was received - can't handle Nested_funcions :INTEGER is 111 -- See EXCEPT_NESTED_FUNCTIONS -- Run time limit exceeded. Due to too many function calls. -- Limit can be increased in the runtime module source code Developer_1 :INTEGER is -1 -- See EXCEPT_DEVELOPER_1 Developer_2 :INTEGER is -2 -- See EXCEPT_DEVELOPER_2 Developer_3 :INTEGER is -3 -- See EXCEPT_DEVELOPER_3 Developer_4 :INTEGER is -4 -- See EXCEPT_DEVELOPER_4 Developer_5 :INTEGER is -5 -- See EXCEPT_DEVELOPER_5 set_exitcode ( code:INTEGER) is -- Set the termination code used upon next abnormal termination. -- Default is 1 external "C" alias "_ert_set_exitcode" end -- set_exitcode except_mode(code, mode:INTEGER) is -- Set signal/raise mode for `code' require exception_mode: code = Continued or code = Caught or code = Ignored external "C" alias "_ert_except_mode" end -- except_mode raise_developer_exception(code:INTEGER) is external "C" alias "_ert_raise_developer_exception" end -- raise_developer_exception end -- class EXCEPTIONS eon3122/basic/file.e000644 000000 000001 00000013406 05710535122 014436 0ustar00rootother000000 000000 -- -- FILE: File data-type -- -- %Z%%Y%:%M% %I% indexing date: "$Date: D T "; revision: "$Revision: R.L $"; authors: roy; names: file class FILE inherit IO_STREAM ; ANY redefine out end creation make_named, make_descriptor feature { ANY} x:INTEGER file_name: STRING -- when not Void, name of file being accessed out: STRING is do !!Result.make_from_string ( file_name) end -- out make_named ( f_name: STRING) is -- create an object referencing a file -- named `file_name' do file_name := f_name end -- make_named make_descriptor ( fd: INTEGER) is -- create an object to reference a file -- already opened on `fd' do file_name := Void stream_id := fd end -- make_descriptor open_read is -- open stream created by `make_named' in read mode require file_name /= Void do stream_id := open ( file_name.to_c, Read_mode) end -- open_read open_write is -- open stream created by `make_named' in write mode require file_name /= Void do stream_id := open ( file_name.to_c, Write_mode) end -- open_read Read_mode: INTEGER is 0 Write_mode: INTEGER is 1 -- -- input features -- lastchar: CHARACTER -- last character read from `Current' input stream by readchar lastint: INTEGER -- last integer read from `Current' input stream by readint lastreal: REAL -- last real read from `Current' input stream by readreal laststring: STRING -- last string read from `Current' input stream by readstream -- or readline readchar is -- assign next character on `Current' input stream to lastchar do lastchar := c_readchar ( stream_id) end -- readchar readint is -- assign next integer on `Current' input stream to lastint do lastint := c_readint ( stream_id) end -- readint readreal is -- assign next real on `Current' input stream to lastreal do lastreal := c_readreal ( stream_id) end -- readreal readline is -- Read a string until a new line or an end of file is encountered -- Make result available in `laststring' -- New line will be consumed but not part of `laststring' local c_str: POINTER do c_str := c_readline ( stream_id) if laststring = Void then !!laststring.make_from_c ( c_str) else laststring.make_from_c ( c_str) end end -- readline readstream ( i: INTEGER) is -- assign next string of `i' characters on -- `Current' input stream to laststring local c_str: POINTER do c_str := c_readstream ( stream_id, i) if laststring = Void then !!laststring.make_from_c ( c_str) else laststring.make_from_c ( c_str) end end -- readstream next_line is -- move to next input line do c_next_line ( stream_id) end -- next_line -- -- output features -- putbool ( b: BOOLEAN) is -- append boolean to (Current) output stream -- in character format ("true"/"false") do if b = True then putstring ( True_string) else putstring ( False_string) end end putchar ( c: CHARACTER) is -- append character to (Current) output stream do c_putchar ( stream_id, c) end putint ( i: INTEGER) is -- append integer to (Current) output stream in character format do c_putint ( stream_id, i) end putreal ( r: REAL) is -- append real to (Current) output stream in character format do c_putreal ( stream_id, r) end putdouble ( d: DOUBLE) is -- append double to (Current) output stream in character format do c_putdouble ( stream_id, d) end putstring ( s: STRING) is -- append string to (Current) output stream do c_putstring ( stream_id, s.to_c) end new_line is -- append a new line character to (Current) output stream do c_putchar ( stream_id, '%N') end stream_id: INTEGER -- file descriptor for file access feature { NONE} c_readchar ( sid: INTEGER): CHARACTER is -- external "C" end -- c_readchar c_readint ( sid: INTEGER): INTEGER is -- external "C" end -- c_readint c_readreal ( sid: INTEGER): REAL is -- external "C" end -- c_readreal c_readline ( sid: INTEGER): POINTER is -- external "C" end -- c_readline c_readstream ( sid, i: INTEGER): POINTER is -- external "C" end -- c_readstream c_next_line ( i: INTEGER) is -- external "C" end -- c_next_line c_putchar ( sid: INTEGER; c: CHARACTER) is -- external "C" end -- c_putchar c_putint ( sid: INTEGER; i: INTEGER) is -- external "C" end -- c_putint c_putreal ( sid: INTEGER; r: REAL) is -- external "C" end -- c_putreal c_putdouble ( sid: INTEGER; d: DOUBLE) is -- external "C" end -- c_putdouble c_putstring ( sid: INTEGER; c_str: POINTER) is -- external "C" end -- c_putstring open ( c_name: POINTER; mode: INTEGER): INTEGER is -- external "C" alias "c_open" end -- open close ( fd: INTEGER) is -- external "C" alias "c_close" end -- close end -- class FILE eon3122/basic/general.e000644 000000 000001 00000013272 05710535122 015135 0ustar00rootother000000 000000 class GENERAL feature -- Void value Void: NONE is -- value of ANY entity when not *attached* to an object once end -- Void is_equal, frozen standard_is_equal ( other: like Current): BOOLEAN is -- Is `other' attached to an object field-by-field identical -- (on common fields) to `Current'? require other_not_void: other /= Void do Result := c_equal ( 0, 1, other) end -- is_equal frozen equal ( some:ANY; other:like some):BOOLEAN is -- Are `some' and `other' both Void or attached to -- to objects field-by-field identical (on fields `some')? -- Defined in terms of `is_equal'. do Result := ( some = Void and other = Void) or else some /= Void and then some.is_equal( other) end -- equal deep_equal, frozen standard_deep_equal ( some:ANY; other:like some):BOOLEAN is -- Are `some' and `other' both Void or attached to -- to recursivly isomorphic object structures? -- Defined in terms of `is_equal'. do Result := ( some = Void and other = Void) or ( some /= Void and other /= Void and then some.c_equal( 1, 1, other)) end -- deep_equal copy, frozen standard_copy ( other: like Current) is -- Copy every field of other onto -- corresponding field of current object require other_not_void: other /= Void do c_copy ( 0, 1, other) end -- copy deep_copy, frozen standard_deep_copy ( other: like Current) is -- Copy field-by-field to `other' require other_not_void: other /= Void do c_copy ( 1, 1, other) end -- deep_copy frozen clone ( other: ANY): like other is -- Void if `other' is void; otherwise, new object -- field-by-field identical to object attached to -- `other'. -- (Defined in terms of `copy') do if other /= Void then !!Result Result.c_copy ( 0, 1, other) end end -- clone deep_clone, frozen standard_deep_clone ( other:ANY):like other is -- Void if `other' is void; otherwise, new object -- field-by-field identical to object attached to -- `other'. -- (Defined in terms of `copy') do if other /= Void then !!Result Result.c_copy ( 1, 1, other) end end -- deep clone io: STD_FILES is -- default IO streams once !!Result.make end -- io except: EXCEPTIONS is -- default exception handler once !!Result end -- except out: STRING is -- This is a fall back for assertions and debugging, it is supposed -- to display a useful string from the object in question. A class -- may want to redefine this ( see STRING). -- Don't add assertions, they will use `out' and infinite -- recursion will result. do !!Result.make_from_string ( "out - not implemented") end -- out print (s: OUT_STREAM) is -- Print `out' to stdout do s.putstring ( out) end -- print generator: STRING is -- Name of the current object's generating class, -- (base class of the type of which it is a direct instance). -- Every call to this function allocates a new result string do !!Result.make_from_c ( c_class_name) end -- generator object_id: STRING is -- Representation of object's value. If current object is a -- complex object, then this value is differant than any other -- in the system - it is unique do !!Result.make_from_int ( c_address_of ( c_object_address)) end -- object_id conforms_to ( other: like Current): BOOLEAN is -- Is dynamic type of current object a descendant -- of dynamic type of other? require not_other_void: other /= Void do Result := id_conforms_to ( other.class_id) end -- conforms_to c_errno: INTEGER is -- Return the C errno variable external "C" alias "_ert_errno" end -- c_errno default_rescue is -- Exception response for routines a Rescue clause -- Default: do nothing do end -- default_rescue feature { GENERAL} class_id: INTEGER -- implementation code for current class -- (this value is automatically set by the implementation) -- to_addr: POINTER is -- -- low-level version of `out': returns a C-pointer to -- -- the printable representation, as a POINTER -- do -- Result := c_object_address -- end -- to_addr c_object_address: POINTER -- address of current object in memory -- (note: this value is set by the implementation) c_class_name: POINTER -- low-level version of `generator': contains a C-pointer to -- the name of the current object's class. Value is constant -- (note: this value is set by the implementation) c_address_of ( sp: POINTER): INTEGER is -- return address of C pointer as an integer external "C" end -- c_address_of c_copy ( deep, top:INTEGER; other:like Current) is -- interface to copy constructor external "C++" alias "_Copy" end -- c_copy c_equal ( deep, top:INTEGER; other:like Current):BOOLEAN is -- interface to copy constructor external "C++" alias "_Equal" end -- c_equal id_conforms_to ( other_id: INTEGER): BOOLEAN is -- is current object's class_id a descendant -- of `other_id'? external "C++" alias "_Conforms_to" end -- conforms_to end -- class GENERAL eon3122/basic/hashable.e000644 000000 000001 00000000642 05710535122 015264 0ustar00rootother000000 000000 indexing description: "Values that may be hashed into an integer index" deferred class HASHABLE feature -- Access hash_code: INTEGER is -- Hash code value require is_hashable deferred ensure valid_hash_value: Result >= 0 end feature -- Status report is_hashable: BOOLEAN is -- May current object be hashed? -- (Answer: if and only if it is not the default value of its type) do end end eon3122/basic/in_stream.e000644 000000 000001 00000002731 05710535122 015477 0ustar00rootother000000 000000 deferred class IN_STREAM feature lastchar: CHARACTER is -- last character read from `Current' input stream by readchar deferred end -- lastchar lastint: INTEGER is -- last integer read from `Current' input stream by readint deferred end -- lastint lastreal: REAL is -- last real read from `Current' input stream by readreal deferred end -- lastreal laststring: STRING is -- last string read from `Current' input stream by readstream -- or readline deferred end -- laststring readchar is -- assign next character on `Current' input stream to lastchar deferred end -- readchar readint is -- assign next integer on `Current' input stream to lastint deferred end -- readint readreal is -- assign next real on `Current' input stream to lastreal deferred end -- readreal readline is -- Read a string until a new line or an end of file is encountered -- Make result available in `laststring' -- New line will be consumed but not part of `laststring' deferred end -- readline readstream ( i: INTEGER) is -- assign next string of `i' characters on -- `Current' input stream to laststring deferred end -- readstream next_line is -- move to next input line deferred end -- next_line end -- class IN_STREAM eon3122/basic/io_stream.e000644 000000 000001 00000000140 05710535122 015470 0ustar00rootother000000 000000 deferred class IO_STREAM inherit IN_STREAM; OUT_STREAM feature end -- class IO_STREAM eon3122/basic/out_stream.e000644 000000 000001 00000001741 05710535122 015700 0ustar00rootother000000 000000 deferred class OUT_STREAM feature putbool ( b: BOOLEAN) is -- append boolean to (Current) output stream -- in character format ("true"/"false") deferred end putchar ( c: CHARACTER) is -- append character to (Current) output stream deferred end putint ( i: INTEGER) is -- append integer to (Current) output stream in character format deferred end putreal ( r: REAL) is -- append real to (Current) output stream in character format deferred end putdouble ( r: DOUBLE) is -- append double to (Current) output stream in character format deferred end putstring ( s: STRING) is -- append string to (Current) output stream deferred end new_line is -- append a new line character to (Current) output stream deferred end False_string: STRING is "false" True_string: STRING is "true" end -- class OUT_STREAM eon3122/basic/platform.e000644 000000 000001 00000003335 05710535122 015343 0ustar00rootother000000 000000 class PLATFORM inherit GENERAL feature Character_bits: INTEGER is -- Number of bits used to represent a character external "C" alias "_ert_char_size" end -- Character_bits Integer_bits: INTEGER is -- Number of bits used to represent a integer external "C" alias "_ert_int_size" end -- Integer_bits Real_bits: INTEGER is -- Number of bits used to represent a real external "C" alias "_ert_real_size" end -- Real_bits Double_bits: INTEGER is -- Number of bits used to represent a double external "C" alias "_ert_double_size" end -- Double_bits Pointer_bits: INTEGER is -- Number of bits used to represent a pointer to a feature external "C" alias "_ert_ptr_size" end -- Pointer_bits Maximum_character_code: INTEGER is -- Maximum supported character code (128 or more) external "C" alias "_ert_max_char" end -- Maximum_character_code bit_size: INTEGER -- number of bits used to store current object Signal_SIGHUP :INTEGER is 1 Signal_SIGINT :INTEGER is 2 Signal_SIGQUIT :INTEGER is 3 Signal_SIGFPE :INTEGER is 8 Signal_SIGKILL :INTEGER is 9 Signal_SIGBUS :INTEGER is 10 Signal_SIGSEGV :INTEGER is 11 Signal_SIGPIPE :INTEGER is 13 Signal_SIGALRM :INTEGER is 14 Signal_SIGTERM :INTEGER is 15 Signal_SIGUSR1 :INTEGER is 16 Signal_SIGUSR2 :INTEGER is 17 -- Signals corrispond to Unix include/sys/signal.h -- Only the most useful/likely to occur are included -- Those that are unavailable on DOS are dummied in -- ert.H invariant Maximum_character_code >= 127 end -- class PLATFORM eon3122/basic/std_files.e000644 000000 000001 00000005554 05710535122 015500 0ustar00rootother000000 000000 class STD_FILES inherit IO_STREAM creation make feature make is -- set-up the standard IO file streams do end -- make input: FILE is -- Standard input file once !!Result.make_descriptor ( 0) end -- input output: FILE is -- Standard output file once !!Result.make_descriptor ( 1) end -- output error: FILE is -- Standard error file once !!Result.make_descriptor ( 3) end -- error putchar, put_char (c: CHARACTER) is -- Write `c' at end of default output. do output.putchar ( c) end -- putchar putstring, put_string (s: STRING) is -- Write `s' at end of default output. do output.putstring ( s) end -- putstring putreal, put_real (r: REAL) is -- Write `r' at end of default output. do output.putreal ( r) end -- putreal putdouble, put_double (d: DOUBLE) is -- Write `d' at end of default output. do output.putdouble ( d) end -- putdouble putint, put_int (i: INTEGER) is -- Write `i' at end of default output. do output.putint ( i) end -- putint putbool, put_bool (b: BOOLEAN) is -- Write `b' at end of default output. do output.putbool ( b) end -- putbool new_line, newline, put_newline is -- Write line feed at end of default output. do output.new_line end -- new_line readint is -- Read a new integer from standard input. do input.readint end -- readint readreal is -- Read a new real from standard input. do input.readreal end -- readreal readline is -- Read a line from standard input. do input.readline end -- readline readstream (nb_char: INTEGER) is -- Read a string of at most `nb_char' bound characters -- from standard input. do input.readstream (nb_char) end -- readstream readchar is -- Read a new character from standard input. do input.readchar end -- readchar next_line is -- Move to next input line on standard input. do input.next_line end -- next_line lastchar: CHARACTER is -- Last character read by readchar do Result := input.lastchar end -- lastchar lastint: INTEGER is -- Last integer read by readint do Result := input.lastint end -- lastint lastreal: REAL is -- Last real read by readreal do Result := input.lastreal end -- lastreal laststring: STRING is -- Last string read by readstring do Result := input.laststring end -- laststring end -- class STD_FILES eon3122/basic/string.e000644 000000 000001 00000031117 05710535123 015025 0ustar00rootother000000 000000 -- -- STRING: String handling -- -- %Z%%Y%:%M% %I% class STRING inherit ANY redefine copy, is_equal, out end creation make, make_from_c, make_from_int, make_from_real, make_from_double, make_from_boolean, make_from_string feature make ( n: INTEGER) is -- Allocate space for at least `n' characters require non_negative_size: n >= 0 do if space = Void then !!space.allocate (n) -- This can't be right end if capacity < n then space.allocate ( n) end ensure space /= Void capacity >= n end -- make make_from_c ( c_string: POINTER) is -- initialise Current from the C-style string -- `c_string', creating current if Void do make ( c_strlen ( c_string) + 1) if capacity > 0 then c_strset ( space.space, c_string) end end -- make_from_c make_from_string ( str:STRING) is -- initialise from another string do make_from_c ( str.to_c) end -- make_from_string make_from_int ( value: INTEGER) is -- initialise Current as a string representation -- of the integer value `value', creating current if Void do make ( 12) if capacity > 0 then c_itoa ( space.space, value) end end -- make_from_int make_from_real ( value: REAL) is -- initialise Current as a string representation -- of the real value `value', creating current if Void do make ( 24) if capacity > 0 then c_rtoa ( space.space, value) end end -- make_from_real make_from_double ( value: DOUBLE) is -- initialise Current as a string representation -- of the double value `value', creating current if Void do make ( 24) if capacity > 0 then c_dtoa ( space.space, value) end end -- make_from_double make_from_boolean ( value: BOOLEAN) is -- initialise Current as a string representation -- of the boolean value `value', creating current if Void do make ( 7) if capacity > 0 then c_btoa ( space.space, value) end end -- make_from_boolean from_c ( c_string: POINTER): STRING is -- return a new STRING instance initialised from the -- C-style string `c_string' do !!Result.make ( c_strlen ( c_string)) c_strset ( Result.space.space, c_string) end -- from_c infix "<=" ( other: like Current): BOOLEAN is -- Is current string less than or equal to `other'? do if c_strcmp ( space.space, other.space.space) >= 0 then Result := True else Result := False end ensure Result implies not ( Current > other) end -- infix "<=" infix "<" ( other: like Current): BOOLEAN is -- Is current string lexicographically lower than `other'? do if c_strcmp ( space.space, other.space.space) < 0 then Result := True else Result := False end end -- infix "<" infix ">=" ( other: like Current): BOOLEAN is -- Is current string greater than or euqual to `other'? do if c_strcmp ( space.space, other.space.space) >= 0 then Result := True else Result := False end ensure Result implies not ( Current < other) end -- infix ">=" infix ">" ( other: like Current): BOOLEAN is -- Is current string greater than `other'? do if c_strcmp ( space.space, other.space.space) > 0 then Result := True else Result := False end ensure Result implies not ( Current <= other) end -- infix ">" adapt ( s: STRING): like Current is -- Object of a type conforming to the type of `s' -- initialised with attributes from `s' do end -- adapt append ( s: STRING) is -- Append a copy of `s' at the end of current string require argument_not_void: s /= Void do space.expand ( count + s.count + 1) if capacity > 0 then c_strcat ( space.space, s.to_c) end ensure -- count = old count + s.count REMOVED UNTIL OLD WORKS!! end -- append capacity: INTEGER is -- Number of characters guaranteed to fit in space -- currently allocated do Result := space.capacity end clear is -- Clear out string do if count /= 0 then space.release end ensure count = 0 end -- clear copy ( other: STRING) is -- Reinitialise with copy of `other' require else other /= Void do ensure then count = other.count -- Forall i: 1 .. count, item(i) = other.item(i) end -- copy count: INTEGER is -- Actual number of characters making up the string do if capacity > 0 then Result := c_strlen ( space.space) end ensure Result >= 0 end -- count empty: BOOLEAN is -- Is the string empty? do if count = 0 then Result := True end end -- empty extend ( c: CHARACTER) is -- Add `c' at end do ensure count = old count + 1 end -- extend fill_blank is -- Fill with blanks do ensure -- Forall i: 1 .. capacity, item(i) = Blank end -- fill_blank hash_code: INTEGER is -- hash code value of current string do end -- hash_code head ( n: INTEGER) is -- Remove all but the first `n' characters, -- do nothing if `n' >= `count' require non_negative_argument: n >= 0 do ensure -- count = min ( n, old count) end -- head index_of ( c: CHARACTER; i: INTEGER): INTEGER is -- Index of the first occurrence of `c', starting at -- position `i'; 0 if not present in current string require index_large_enough: i >= 1 index_small_enough: i <= count do ensure -- Result = 0 or item ( Result) = c end -- index_of is_equal ( other: STRING): BOOLEAN is -- Is current string made of same character sequence as `other'? do if c_strcmp ( Current.to_c, other.to_c) = 0 then Result := True end end -- is_equal item, infix "@" ( i: INTEGER): CHARACTER is -- Character at position `i' require index_large_enough: i >= 1 index_small_enough: i <= count do Result := c_item ( space.space, i) end -- item, infix "@" item_code ( i: INTEGER): INTEGER is -- Numeric code of character at position `i' require index_large_enough: i >= 1 index_small_enough: i <= count do end -- item_code left_adjust is -- Remove leading blanks do ensure (count /= 0) implies (item(1) /= ' ') end -- left_adjust precede ( c: CHARACTER) is -- Add `c' at front do ensure count = old count + 1 end -- precede prepend ( s: STRING) is -- Prepend a copy of `s' at front of current string require argument_not_void: s /= Void do ensure count = old count + s.count end -- prepend put ( c: CHARACTER; i: INTEGER) is -- Replace by `c' character at position `i' require index_large_enough: i >= 1 index_small_enough: i <= count do ensure item ( i) = c end -- put remove ( i: INTEGER) is -- Remove `i'-th character require index_large_enough: i >= 1 index_small_enough: i <= count do ensure count = old count - 1 end -- remove remove_all_occurrences ( c: CHARACTER) is -- Remove all occurrences of `c' from current string do ensure -- Forall i: 1 .. count, item(i) /= c -- count = old count - `number of occurrecnes of c in old Current' end -- remove_all_occurrences resize ( newsize: INTEGER) is -- Reallocate if needed to accomodate at least `newsize' -- Do not lose any characters from the existing string require new_size_non_negative: newsize >= 0 do if newsize > capacity then space.expand ( newsize) end ensure count >= newsize count >= old count end -- resize right_adjust is -- Remove trailing blanks do ensure -- count /= 0 implies item ( count) /= ' ' end -- right_adjust shrink ( s: STRING; n1, n2: INTEGER) is -- Reset from `s', removing characters outside of interval `n1' .. `n2' require argument_not_void: s /= Void meaningful_origin: 1 <= n1 meaningful_interval: n1 <= n2 meaningful_end: n2 <= s.count do ensure is_equal ( s.substring ( n1, n2)) end -- shrink substring ( n1, n2: INTEGER): STRING is -- Copy of sub-string of current string containing all -- characters at indicies between `n1' and `n2' require meaningful_origin: 1 <= n1 meaningful_interval: n1 <= n2 meaningful_end: n2 <= count do ensure Result.count = n2 - n1 + 1 -- Forall i: 1 .. n2-n1, Result.item(i) = item(n1 + i - 1) end -- substring tail ( n: INTEGER) is -- Remove all characters except for the last `n' -- do nothing if `n' >= `count' require non_negative_argument: n >= 0 do ensure -- count = min ( n, old count) end -- tail to_c: POINTER is -- A value which a C function may cast into a pointer to a -- C form of the string. Useful only for interfacing with C software. -- Caveat: because C uses null characters as end marker for strings, -- a null character occurring in an Eiffel string passed to C will -- prevent C functions from accessing any character past the null do Result := space.space end -- to_c out: STRING is -- Printable representation of current string (redefined from ANY) do -- -- DANGER - SHOULD CHECK TO SEE IF A STRING HAS BEEN DEFINED -- Result := Current end -- out to_integer: INTEGER is -- Integer value of current string, assumed to contain digits only -- when applied to "123" will yield 123 require -- String containing digits only do Result := c_atoi ( space.space) end -- to_integer to_lower is -- Convert string to lower-case do end -- to_lower to_upper is -- Convert string to upper-case do end -- to_upper feature { STRING } space: CORE -- string stored in here feature { NONE } c_strlen ( s: POINTER): INTEGER is -- count of bytes until first 0 in `space' external "C" end -- c_strlen c_strcmp ( s1, s2: POINTER): INTEGER is -- compare `s1' and `s2', returning 0 if they match external "C" end -- c_strcmp c_strset ( target, source: POINTER) is -- copy string from `source' (a C-string) into `target' external "C" end -- c_strset c_strcat ( target, source: POINTER) is -- concaternate string from `source' (a C-string) onto `target' external "C" end -- c_strcat c_atoi ( str: POINTER): INTEGER is -- return integer representation of string's contents external "C" end -- c_atoi c_itoa ( sp: POINTER; value: INTEGER) is -- set C-string `sp' from integer `value' external "C" end -- c_itoa c_rtoa ( sp: POINTER; value: REAL) is -- set C-string `sp' from real `value' external "C" end -- c_rtoa c_dtoa ( sp: POINTER; value: DOUBLE) is -- set C-string `sp' from double `value' external "C" end -- c_dtoa c_btoa ( sp: POINTER; value: BOOLEAN) is -- set C-string `sp' from boolean `value' external "C" end -- c_btoa c_item ( str: POINTER; index: INTEGER): CHARACTER is -- return integer representation of string's contents external "C" end -- c_item invariant 0 <= count count <= capacity end -- class STRING eon3122/bibt000755 000000 000001 00000000000 05710535120 013123 5ustar00rootother000000 000000 eon3122/bibt/array.e000644 000000 000001 00000007776 05710535114 014512 0ustar00rootother000000 000000 CLASS ARRAY [ T] inherit ANY redefine copy, is_equal end creation make feature {ANY} lower: INTEGER -- Minimum index upper: INTEGER -- Maximum index count: INTEGER -- Number of available indecies all_cleared: BOOLEAN -- Are all items set to default values? clear_all is -- Reset all items to default values do end -- clear_all make ( minindex, maxindex: INTEGER) is -- Allocate array; set interval to `minindex' - `maxindex' -- (empty if `minindex' > `maxindex') do resize ( minindex, maxindex) ensure minindex > maxindex implies count = 0 minindex <= maxindex implies count = maxindex - minindex + 1 end -- make is_equal ( other: ARRAY [ T]): BOOLEAN is -- Test if Current and `other' are -- elementwise equal. If `T' is of -- reference type, simple reference -- equality is used. local index, other_index: INTEGER do if other.count = count then Result := True from index := lower other_index := other.lower until index > upper or Result = False loop Result := item ( index).is_equal ( other.item(other_index)) index := index + 1 other_index := other_index + 1 end end ensure then other.count /= count implies Result = False end -- is_equal copy ( other: ARRAY [ T]) is -- Copy `other' elementwise onto Current. -- If `T' is of reference type, only the -- references will be copied. do end insert ( element: T; index: INTEGER) is -- Insert `element' after position `index'. require inside_bounds: lower - 1 <= index and then index < upper -- Note: Insertion is AFTER `index'! -- Element at position `upper' will be lost! do end item ( index: INTEGER): T is -- Item at position `index'. require inside_bounds: lower <= index and then index <= upper do Result := get_element ( space.space, index - lower) ensure Result /= Void end put ( element: T; index: INTEGER) is -- Put `element' at position `index'. require inside_bounds: lower <= index and then index <= upper do set_element ( space.space, index - lower, element) end remove ( index: INTEGER) is -- Remove element at position `index'. -- Elements after `index' will move -- one position left ( =towards lower indices). require inside_bounds: lower <= index and then index <= upper do end resize ( minindex, maxindex: INTEGER) is -- Rearrange array so that it can accomodate indicies down to `minindex' -- and up to `maxindex'. Preserves current array contents do if (maxindex - minindex + 1) > count then if space = Void then !!space.allocate(1) end space.expand ( (maxindex - minindex + 1) * (Pointer_bits / 8)) lower := minindex upper := maxindex count := (maxindex - minindex + 1) + count end ensure lower <= minindex maxindex <= upper end -- resize feature {NONE} space: CORE -- where array is stored get_element ( area: POINTER; index: INTEGER): T is -- answer with value at position `index' external "C" alias "_ert_array_item" end -- get_element set_element ( area: POINTER; index: INTEGER; data: T) is -- set value at position `index' to `data' external "C" alias "_ert_array_put" end -- set_element end -- class ARRAY [ T] eon3122/bibt/boolean.e000644 000000 000001 00000000761 05710535114 014776 0ustar00rootother000000 000000 -- -- This is a dummy class to load validation information into the database -- class BOOLEAN inherit BOOLEAN_REF feature --infix "and" ( other:BOOLEAN):BOOLEAN is do end --infix "and then" ( other:BOOLEAN):BOOLEAN is do end --infix "implies" ( other:BOOLEAN):BOOLEAN is do end --prefix "not" ( other:BOOLEAN):BOOLEAN is do end --infix "or" ( other:BOOLEAN):BOOLEAN is do end --infix "or else" ( other:BOOLEAN):BOOLEAN is do end --infix "xor" ( other:BOOLEAN):BOOLEAN is do end end eon3122/bibt/char.e000644 000000 000001 00000000520 05710535114 014265 0ustar00rootother000000 000000 -- -- This is a dummy class to load validation information into the database -- class CHARACTER inherit CHAR_REF feature infix "<" ( other:CHARACTER):BOOLEAN is do end infix ">=" ( other:like Current):BOOLEAN is do end infix ">" ( other:like Current):BOOLEAN is do end infix "<=" ( other:like Current):BOOLEAN is do end end eon3122/bibt/comparab.e000666 000000 000001 00000001677 05710535114 015156 0ustar00rootother000000 000000 deferred class COMPARABLE feature infix "<" (other: like Current): BOOLEAN is -- Is current element less than `other'? deferred ensure Result implies (not (Current >= other)) end -- "<" infix "<=" (other: like Current): BOOLEAN is -- Is current element less than or equal to `other'? do Result := not (other < Current) ensure Result implies (not (Current > other)) end -- "<=" infix ">" (other: like Current): BOOLEAN is -- Is current element greater than `other'? do Result := other < Current ensure Result implies (not (Current <= other)) end -- ">" infix ">=" (other: like Current): BOOLEAN is -- Is current element greater than or equal to `other'? do Result := not (Current < other) ensure Result implies (not (Current < other)) end -- ">=" end -- class COMPARABLE eon3122/bibt/double.e000644 000000 000001 00000001153 05710535115 014626 0ustar00rootother000000 000000 -- -- This is a dummy class to load validation information into the database -- class DOUBLE inherit NUMERIC; DOUBLE_REF feature infix "<" ( other:DOUBLE):BOOLEAN is do end infix ">=" ( other:like Current):BOOLEAN is do end infix ">" ( other:like Current):BOOLEAN is do end infix "<=" ( other:like Current):BOOLEAN is do end infix "*" ( other:DOUBLE):DOUBLE is do end prefix "+":DOUBLE is do end infix "+" ( other:DOUBLE):DOUBLE is do end prefix "-":DOUBLE is do end infix "-" ( other:DOUBLE):DOUBLE is do end infix "/" ( other:DOUBLE):REAL is do end infix "^" ( other:DOUBLE):DOUBLE is do end end eon3122/bibt/integer.e000644 000000 000001 00000001334 05710535115 015012 0ustar00rootother000000 000000 -- -- This is a dummy class to load validation information into the database -- class INTEGER inherit NUMERIC; INTEGER_REF end feature infix "<" ( other:INTEGER):BOOLEAN is do end infix ">=" ( other:like Current):BOOLEAN is do end infix ">" ( other:like Current):BOOLEAN is do end infix "<=" ( other:like Current):BOOLEAN is do end infix "*" ( other:INTEGER):INTEGER is do end prefix "+":INTEGER is do end infix "+" ( other:INTEGER):INTEGER is do end prefix "-":INTEGER is do end infix "-" ( other:INTEGER):INTEGER is do end infix "/" ( other:INTEGER):REAL is do end infix "//" ( other:INTEGER):INTEGER is do end infix "\\" ( other:INTEGER):INTEGER is do end infix "^" ( other:INTEGER):INTEGER is do end end eon3122/bibt/numeric.e000666 000000 000001 00000002137 05710535115 015025 0ustar00rootother000000 000000 deferred class NUMERIC inherit COMPARABLE feature infix "*" ( other: NUMERIC): like Current is -- answer with result of multipling `Current' by `other' deferred end -- infix "*" prefix "+": like Current is -- answer with result of unary addition on `Current' deferred end -- prefix "+" infix "+" ( other: NUMERIC): like Current is -- answer with result of adding `Current' to `other' deferred end -- infix "+" prefix "-": like Current is -- answer with result of unary subtraction on `Current' deferred end -- prefix "-" infix "-" ( other: NUMERIC): like Current is -- answer with result of subtracting `Current' from `other' deferred end -- infix "-" infix "/" ( other: NUMERIC): like Current is -- answer with result of dividing `Current' by `other' deferred end -- infix "/" infix "^" ( other: NUMERIC): like Current is -- answer with result of raising `Current' to the power of `other' deferred end -- infix "*" end -- class NUMERIC eon3122/bibt/real.e000644 000000 000001 00000001124 05710535115 014275 0ustar00rootother000000 000000 -- -- This is a dummy class to load validation information into the database -- class REAL inherit NUMERIC; REAL_REF end feature infix "<" ( other:REAL):BOOLEAN is do end infix ">=" ( other:like Current):BOOLEAN is do end infix ">" ( other:like Current):BOOLEAN is do end infix "<=" ( other:like Current):BOOLEAN is do end infix "*" ( other:REAL):REAL is do end prefix "+":REAL is do end infix "+" ( other:REAL):REAL is do end prefix "-":REAL is do end infix "-" ( other:REAL):REAL is do end infix "/" ( other:REAL):REAL is do end infix "^" ( other:REAL):REAL is do end end eon3122/bibt/bool_ref.cc000644 000000 000001 00000007240 05710535117 015311 0ustar00rootother000000 000000 /* * * Non-expanded forms of basic type */ #include #include #include #include #include #include class STRING; BOOLEAN_REF::BOOLEAN_REF () { #ifdef _BOOLEAN_REF_H val = false; #else val = 0; #endif class_id = _bibt_BOOLEAN_REF_id; /* defined in ert.H */ c_object_address = (POINTER) this; c_class_name = (POINTER) "BOOLEAN_REF"; } void BOOLEAN_REF::set_value ( BOOLEAN v) { val = v; } BOOLEAN BOOLEAN_REF::item () { return val; } void BOOLEAN_REF::_Copy ( int deep, int sclass, BOOLEAN_REF* v) { val = v->val; } BOOLEAN BOOLEAN_REF::_Equal ( int deep, int sclass, BOOLEAN_REF* v) { return v->val == val ? true : false; } STRING* BOOLEAN_REF::out() { STRING *result; result = new STRING; result->make_from_boolean ( val); return result; } /* BUG! we don't have STD_FILES available */ void BOOLEAN_REF::print ( ANY *s) { fprintf ( stderr, "%d", val); } BOOLEAN_REF* BOOLEAN_REF::_Clone ( int deep, int sclass, BOOLEAN_REF *_arg) { BOOLEAN_REF *r = new BOOLEAN_REF; r->val = _arg->val; return r; } BOOLEAN_REF* _ert_clone_BOOLEAN ( BOOLEAN v) { BOOLEAN_REF *result; result = new BOOLEAN_REF; result->val = v; return result; } BOOLEAN_REF* _ert_clone_BOOLEAN_REF ( BOOLEAN_REF *v) { if ( v) { BOOLEAN_REF *result; result = new BOOLEAN_REF; result->val = v->val; return result; } return ( BOOLEAN_REF *) 0; } BOOLEAN_REF *_BOOLEAN_REF_chk(BOOLEAN_REF *rtc, char *fname) { if ( !rtc) _eiffel_rt_Assert ( 107, "BOOLEAN_REF", fname, "void target", false, _ert_longjmp()); return rtc; } BOOLEAN BOOLEAN_REF::is_equal (BOOLEAN_REF* p1) { return _Equal( 1, 1, p1); } BOOLEAN BOOLEAN_REF::equal (ANY* p1, BOOLEAN_REF* p2) { return (p1)->_Equal ( 0, 1, p2); } void BOOLEAN_REF::copy ( BOOLEAN_REF* p1) { _Copy ( 0, 1, p1); } BOOLEAN_REF* BOOLEAN_REF::clone (BOOLEAN_REF *x) { return _Clone( 0, 1, x); } BOOLEAN_REF* BOOLEAN_REF::_localClone ( int deep, int sclass) { BOOLEAN_REF *r = new BOOLEAN_REF; r->val = val; return r; } BOOLEAN BOOLEAN_REF::deep_equal ( BOOLEAN_REF* p1, BOOLEAN_REF* p2) { return p1->_Equal ( 1, 1, p2); } void BOOLEAN_REF::deep_copy ( BOOLEAN_REF* p1) { _Copy ( 1, 1, p1); } BOOLEAN_REF* BOOLEAN_REF::deep_clone ( BOOLEAN_REF *x) { return _Clone (1,1,x); } BOOLEAN_REF* _bibt_BOOLEAN_BOOLEAN_REF ( BOOLEAN v) { BOOLEAN_REF *result; result = new BOOLEAN_REF; result->set_value ( v); return result; } #ifndef _BOOLEAN_REF_H BOOLEAN BOOLEAN_REF::_INFIX_LEQ ( BOOLEAN_REF* other) { return val < _BOOLEAN_REF_chk ( other, "other")->val ? _ert_BOOLEAN_Const ( true) : _ert_BOOLEAN_Const ( false); } BOOLEAN_REF* BOOLEAN_REF::_INFIX_ADD ( BOOLEAN_REF* other) { BOOLEAN_REF *r = new BOOLEAN_REF; r->val = _BOOLEAN_REF_chk ( other, "other")->val + val; return r; } BOOLEAN_REF* BOOLEAN_REF::_INFIX_SUB ( BOOLEAN_REF* other) { BOOLEAN_REF *r = new BOOLEAN_REF; r->val = _BOOLEAN_REF_chk ( other, "other")->val - val; return r; } BOOLEAN_REF* BOOLEAN_REF::_INFIX_MUL ( BOOLEAN_REF* other) { BOOLEAN_REF *r = new BOOLEAN_REF; r->val = _BOOLEAN_REF_chk ( other, "other")->val * val; return r; } BOOLEAN_REF* BOOLEAN_REF::_INFIX_DIV ( BOOLEAN_REF* other) { BOOLEAN_REF *r = new BOOLEAN_REF; r->val = _BOOLEAN_REF_chk ( other, "other")->val / val; return r; } #endif /* _BOOLEAN_REF_H */ BOOLEAN BOOLEAN_REF::_Conforms_to ( int other_id) /* Don't use BOOLEAN */ { if ( class_id == other_id) return true; #ifdef _BOOLEAN_REF_H { ANY a; return a._Conforms_to ( other_id); } #else { NUMERIC n; if ( n.class_id == other_id) return true; return n._Conforms_to ( other_id); } #endif } eon3122/bibt/char_ref.cc000644 000000 000001 00000007526 05710535117 015302 0ustar00rootother000000 000000 /* * * Non-expanded forms of basic type */ #include #include #include #include #include #include class STRING; CHARACTER_REF::CHARACTER_REF () { #ifdef _BOOLEAN_REF_H val = false; #else val = 0; #endif class_id = _bibt_CHARACTER_REF_id; /* defined in ert.H */ c_object_address = (POINTER) this; c_class_name = (POINTER) "CHARACTER_REF"; } void CHARACTER_REF::set_value ( CHARACTER v) { val = v; } CHARACTER CHARACTER_REF::item () { return val; } void CHARACTER_REF::_Copy ( int deep, int sclass, CHARACTER_REF* v) { val = v->val; } BOOLEAN CHARACTER_REF::_Equal ( int deep, int sclass, CHARACTER_REF* v) { return v->val == val ? true : false; } STRING* CHARACTER_REF::out() { STRING *result; result = new STRING; result->make_from_character ( val); return result; } /* BUG! we don't have STD_FILES available */ void CHARACTER_REF::print ( ANY *s) { fprintf ( stderr, "%d", val); } CHARACTER_REF* CHARACTER_REF::_Clone ( int deep, int sclass, CHARACTER_REF *_arg) { CHARACTER_REF *r = new CHARACTER_REF; r->val = _arg->val; return r; } CHARACTER_REF* _ert_clone_CHARACTER ( CHARACTER v) { CHARACTER_REF *result; result = new CHARACTER_REF; result->val = v; return result; } CHARACTER_REF* _ert_clone_CHARACTER_REF ( CHARACTER_REF *v) { if ( v) { CHARACTER_REF *result; result = new CHARACTER_REF; result->val = v->val; return result; } return ( CHARACTER_REF *) 0; } CHARACTER_REF *_CHARACTER_REF_chk(CHARACTER_REF *rtc, char *fname) { if ( !rtc) _eiffel_rt_Assert ( 107, "CHARACTER_REF", fname, "void target", false, _ert_longjmp()); return rtc; } BOOLEAN CHARACTER_REF::is_equal (CHARACTER_REF* p1) { return _Equal( 1, 1, p1); } BOOLEAN CHARACTER_REF::equal (ANY* p1, CHARACTER_REF* p2) { return (p1)->_Equal ( 0, 1, p2); } void CHARACTER_REF::copy ( CHARACTER_REF* p1) { _Copy ( 0, 1, p1); } CHARACTER_REF* CHARACTER_REF::clone (CHARACTER_REF *x) { return _Clone( 0, 1, x); } CHARACTER_REF* CHARACTER_REF::_localClone ( int deep, int sclass) { CHARACTER_REF *r = new CHARACTER_REF; r->val = val; return r; } BOOLEAN CHARACTER_REF::deep_equal ( CHARACTER_REF* p1, CHARACTER_REF* p2) { return p1->_Equal ( 1, 1, p2); } void CHARACTER_REF::deep_copy ( CHARACTER_REF* p1) { _Copy ( 1, 1, p1); } CHARACTER_REF* CHARACTER_REF::deep_clone ( CHARACTER_REF *x) { return _Clone (1,1,x); } CHARACTER_REF* _bibt_CHARACTER_CHARACTER_REF ( CHARACTER v) { CHARACTER_REF *result; result = new CHARACTER_REF; result->set_value ( v); return result; } #ifndef _BOOLEAN_REF_H BOOLEAN CHARACTER_REF::_INFIX_LEQ ( CHARACTER_REF* other) { return val < _CHARACTER_REF_chk ( other, "other")->val ? _ert_BOOLEAN_Const ( true) : _ert_BOOLEAN_Const ( false); } CHARACTER_REF* CHARACTER_REF::_INFIX_ADD ( CHARACTER_REF* other) { CHARACTER_REF *r = new CHARACTER_REF; r->val = _CHARACTER_REF_chk ( other, "other")->val + val; return r; } CHARACTER_REF* CHARACTER_REF::_INFIX_SUB ( CHARACTER_REF* other) { CHARACTER_REF *r = new CHARACTER_REF; r->val = _CHARACTER_REF_chk ( other, "other")->val - val; return r; } CHARACTER_REF* CHARACTER_REF::_INFIX_MUL ( CHARACTER_REF* other) { CHARACTER_REF *r = new CHARACTER_REF; r->val = _CHARACTER_REF_chk ( other, "other")->val * val; return r; } CHARACTER_REF* CHARACTER_REF::_INFIX_DIV ( CHARACTER_REF* other) { CHARACTER_REF *r = new CHARACTER_REF; r->val = _CHARACTER_REF_chk ( other, "other")->val / val; return r; } #endif /* _BOOLEAN_REF_H */ BOOLEAN CHARACTER_REF::_Conforms_to ( int other_id) /* Don't use CHARACTER */ { if ( class_id == other_id) return true; #ifdef _BOOLEAN_REF_H { ANY a; return a._Conforms_to ( other_id); } #else { NUMERIC n; if ( n.class_id == other_id) return true; return n._Conforms_to ( other_id); } #endif } eon3122/bibt/dbl_ref.cc000644 000000 000001 00000007104 05710535117 015116 0ustar00rootother000000 000000 /* * * Non-expanded forms of basic type */ #include #include #include #include #include #include class STRING; DOUBLE_REF::DOUBLE_REF () { #ifdef _BOOLEAN_REF_H val = false; #else val = 0; #endif class_id = _bibt_DOUBLE_REF_id; /* defined in ert.H */ c_object_address = (POINTER) this; c_class_name = (POINTER) "DOUBLE_REF"; } void DOUBLE_REF::set_value ( DOUBLE v) { val = v; } DOUBLE DOUBLE_REF::item () { return val; } void DOUBLE_REF::_Copy ( int deep, int sclass, DOUBLE_REF* v) { val = v->val; } BOOLEAN DOUBLE_REF::_Equal ( int deep, int sclass, DOUBLE_REF* v) { return v->val == val ? true : false; } STRING* DOUBLE_REF::out() { STRING *result; result = new STRING; result->make_from_double ( val); return result; } /* BUG! we don't have STD_FILES available */ void DOUBLE_REF::print ( ANY *s) { fprintf ( stderr, "%d", val); } DOUBLE_REF* DOUBLE_REF::_Clone ( int deep, int sclass, DOUBLE_REF *_arg) { DOUBLE_REF *r = new DOUBLE_REF; r->val = _arg->val; return r; } DOUBLE_REF* _ert_clone_DOUBLE ( DOUBLE v) { DOUBLE_REF *result; result = new DOUBLE_REF; result->val = v; return result; } DOUBLE_REF* _ert_clone_DOUBLE_REF ( DOUBLE_REF *v) { if ( v) { DOUBLE_REF *result; result = new DOUBLE_REF; result->val = v->val; return result; } return ( DOUBLE_REF *) 0; } DOUBLE_REF *_DOUBLE_REF_chk(DOUBLE_REF *rtc, char *fname) { if ( !rtc) _eiffel_rt_Assert ( 107, "DOUBLE_REF", fname, "void target", false, _ert_longjmp()); return rtc; } BOOLEAN DOUBLE_REF::is_equal (DOUBLE_REF* p1) { return _Equal( 1, 1, p1); } BOOLEAN DOUBLE_REF::equal (ANY* p1, DOUBLE_REF* p2) { return (p1)->_Equal ( 0, 1, p2); } void DOUBLE_REF::copy ( DOUBLE_REF* p1) { _Copy ( 0, 1, p1); } DOUBLE_REF* DOUBLE_REF::clone (DOUBLE_REF *x) { return _Clone( 0, 1, x); } DOUBLE_REF* DOUBLE_REF::_localClone ( int deep, int sclass) { DOUBLE_REF *r = new DOUBLE_REF; r->val = val; return r; } BOOLEAN DOUBLE_REF::deep_equal ( DOUBLE_REF* p1, DOUBLE_REF* p2) { return p1->_Equal ( 1, 1, p2); } void DOUBLE_REF::deep_copy ( DOUBLE_REF* p1) { _Copy ( 1, 1, p1); } DOUBLE_REF* DOUBLE_REF::deep_clone ( DOUBLE_REF *x) { return _Clone (1,1,x); } DOUBLE_REF* _bibt_DOUBLE_DOUBLE_REF ( DOUBLE v) { DOUBLE_REF *result; result = new DOUBLE_REF; result->set_value ( v); return result; } #ifndef _BOOLEAN_REF_H BOOLEAN DOUBLE_REF::_INFIX_LEQ ( DOUBLE_REF* other) { return val < _DOUBLE_REF_chk ( other, "other")->val ? _ert_BOOLEAN_Const ( true) : _ert_BOOLEAN_Const ( false); } DOUBLE_REF* DOUBLE_REF::_INFIX_ADD ( DOUBLE_REF* other) { DOUBLE_REF *r = new DOUBLE_REF; r->val = _DOUBLE_REF_chk ( other, "other")->val + val; return r; } DOUBLE_REF* DOUBLE_REF::_INFIX_SUB ( DOUBLE_REF* other) { DOUBLE_REF *r = new DOUBLE_REF; r->val = _DOUBLE_REF_chk ( other, "other")->val - val; return r; } DOUBLE_REF* DOUBLE_REF::_INFIX_MUL ( DOUBLE_REF* other) { DOUBLE_REF *r = new DOUBLE_REF; r->val = _DOUBLE_REF_chk ( other, "other")->val * val; return r; } DOUBLE_REF* DOUBLE_REF::_INFIX_DIV ( DOUBLE_REF* other) { DOUBLE_REF *r = new DOUBLE_REF; r->val = _DOUBLE_REF_chk ( other, "other")->val / val; return r; } #endif /* _BOOLEAN_REF_H */ BOOLEAN DOUBLE_REF::_Conforms_to ( int other_id) /* Don't use DOUBLE */ { if ( class_id == other_id) return true; #ifdef _BOOLEAN_REF_H { ANY a; return a._Conforms_to ( other_id); } #else { NUMERIC n; if ( n.class_id == other_id) return true; return n._Conforms_to ( other_id); } #endif } eon3122/bibt/int_ref.cc000644 000000 000001 00000007233 05710535117 015152 0ustar00rootother000000 000000 /* * * Non-expanded forms of basic type */ #include #include #include #include #include #include class STRING; INTEGER_REF::INTEGER_REF () { #ifdef _BOOLEAN_REF_H val = false; #else val = 0; #endif class_id = _bibt_INTEGER_REF_id; /* defined in ert.H */ c_object_address = (POINTER) this; c_class_name = (POINTER) "INTEGER_REF"; } void INTEGER_REF::set_value ( INTEGER v) { val = v; } INTEGER INTEGER_REF::item () { return val; } void INTEGER_REF::_Copy ( int deep, int sclass, INTEGER_REF* v) { val = v->val; } BOOLEAN INTEGER_REF::_Equal ( int deep, int sclass, INTEGER_REF* v) { return v->val == val ? true : false; } STRING* INTEGER_REF::out() { STRING *result; result = new STRING; result->make_from_int ( val); return result; } /* BUG! we don't have STD_FILES available */ void INTEGER_REF::print ( ANY *s) { fprintf ( stderr, "%d", val); } INTEGER_REF* INTEGER_REF::_Clone ( int deep, int sclass, INTEGER_REF *_arg) { INTEGER_REF *r = new INTEGER_REF; r->val = _arg->val; return r; } INTEGER_REF* _ert_clone_INTEGER ( INTEGER v) { INTEGER_REF *result; result = new INTEGER_REF; result->val = v; return result; } INTEGER_REF* _ert_clone_INTEGER_REF ( INTEGER_REF *v) { if ( v) { INTEGER_REF *result; result = new INTEGER_REF; result->val = v->val; return result; } return ( INTEGER_REF *) 0; } INTEGER_REF *_INTEGER_REF_chk(INTEGER_REF *rtc, char *fname) { if ( !rtc) _eiffel_rt_Assert ( 107, "INTEGER_REF", fname, "void target", false, _ert_longjmp()); return rtc; } BOOLEAN INTEGER_REF::is_equal (INTEGER_REF* p1) { return _Equal( 1, 1, p1); } BOOLEAN INTEGER_REF::equal (ANY* p1, INTEGER_REF* p2) { return (p1)->_Equal ( 0, 1, p2); } void INTEGER_REF::copy ( INTEGER_REF* p1) { _Copy ( 0, 1, p1); } INTEGER_REF* INTEGER_REF::clone (INTEGER_REF *x) { return _Clone( 0, 1, x); } INTEGER_REF* INTEGER_REF::_localClone ( int deep, int sclass) { INTEGER_REF *r = new INTEGER_REF; r->val = val; return r; } BOOLEAN INTEGER_REF::deep_equal ( INTEGER_REF* p1, INTEGER_REF* p2) { return p1->_Equal ( 1, 1, p2); } void INTEGER_REF::deep_copy ( INTEGER_REF* p1) { _Copy ( 1, 1, p1); } INTEGER_REF* INTEGER_REF::deep_clone ( INTEGER_REF *x) { return _Clone (1,1,x); } INTEGER_REF* _bibt_INTEGER_INTEGER_REF ( INTEGER v) { INTEGER_REF *result; result = new INTEGER_REF; result->set_value ( v); return result; } #ifndef _BOOLEAN_REF_H BOOLEAN INTEGER_REF::_INFIX_LEQ ( INTEGER_REF* other) { return val < _INTEGER_REF_chk ( other, "other")->val ? _ert_BOOLEAN_Const ( true) : _ert_BOOLEAN_Const ( false); } INTEGER_REF* INTEGER_REF::_INFIX_ADD ( INTEGER_REF* other) { INTEGER_REF *r = new INTEGER_REF; r->val = _INTEGER_REF_chk ( other, "other")->val + val; return r; } INTEGER_REF* INTEGER_REF::_INFIX_SUB ( INTEGER_REF* other) { INTEGER_REF *r = new INTEGER_REF; r->val = _INTEGER_REF_chk ( other, "other")->val - val; return r; } INTEGER_REF* INTEGER_REF::_INFIX_MUL ( INTEGER_REF* other) { INTEGER_REF *r = new INTEGER_REF; r->val = _INTEGER_REF_chk ( other, "other")->val * val; return r; } INTEGER_REF* INTEGER_REF::_INFIX_DIV ( INTEGER_REF* other) { INTEGER_REF *r = new INTEGER_REF; r->val = _INTEGER_REF_chk ( other, "other")->val / val; return r; } #endif /* _BOOLEAN_REF_H */ BOOLEAN INTEGER_REF::_Conforms_to ( int other_id) /* Don't use INTEGER */ { if ( class_id == other_id) return true; #ifdef _BOOLEAN_REF_H { ANY a; return a._Conforms_to ( other_id); } #else { NUMERIC n; if ( n.class_id == other_id) return true; return n._Conforms_to ( other_id); } #endif } eon3122/bibt/real_ref.cc000644 000000 000001 00000006617 05710535117 015310 0ustar00rootother000000 000000 /* * * Non-expanded forms of basic type */ #include #include #include #include #include #include class STRING; REAL_REF::REAL_REF () { #ifdef _BOOLEAN_REF_H val = false; #else val = 0; #endif class_id = _bibt_REAL_REF_id; /* defined in ert.H */ c_object_address = (POINTER) this; c_class_name = (POINTER) "REAL_REF"; } void REAL_REF::set_value ( REAL v) { val = v; } REAL REAL_REF::item () { return val; } void REAL_REF::_Copy ( int deep, int sclass, REAL_REF* v) { val = v->val; } BOOLEAN REAL_REF::_Equal ( int deep, int sclass, REAL_REF* v) { return v->val == val ? true : false; } STRING* REAL_REF::out() { STRING *result; result = new STRING; result->make_from_real ( val); return result; } /* BUG! we don't have STD_FILES available */ void REAL_REF::print ( ANY *s) { fprintf ( stderr, "%d", val); } REAL_REF* REAL_REF::_Clone ( int deep, int sclass, REAL_REF *_arg) { REAL_REF *r = new REAL_REF; r->val = _arg->val; return r; } REAL_REF* _ert_clone_REAL ( REAL v) { REAL_REF *result; result = new REAL_REF; result->val = v; return result; } REAL_REF* _ert_clone_REAL_REF ( REAL_REF *v) { if ( v) { REAL_REF *result; result = new REAL_REF; result->val = v->val; return result; } return ( REAL_REF *) 0; } REAL_REF *_REAL_REF_chk(REAL_REF *rtc, char *fname) { if ( !rtc) _eiffel_rt_Assert ( 107, "REAL_REF", fname, "void target", false, _ert_longjmp()); return rtc; } BOOLEAN REAL_REF::is_equal (REAL_REF* p1) { return _Equal( 1, 1, p1); } BOOLEAN REAL_REF::equal (ANY* p1, REAL_REF* p2) { return (p1)->_Equal ( 0, 1, p2); } void REAL_REF::copy ( REAL_REF* p1) { _Copy ( 0, 1, p1); } REAL_REF* REAL_REF::clone (REAL_REF *x) { return _Clone( 0, 1, x); } REAL_REF* REAL_REF::_localClone ( int deep, int sclass) { REAL_REF *r = new REAL_REF; r->val = val; return r; } BOOLEAN REAL_REF::deep_equal ( REAL_REF* p1, REAL_REF* p2) { return p1->_Equal ( 1, 1, p2); } void REAL_REF::deep_copy ( REAL_REF* p1) { _Copy ( 1, 1, p1); } REAL_REF* REAL_REF::deep_clone ( REAL_REF *x) { return _Clone (1,1,x); } REAL_REF* _bibt_REAL_REAL_REF ( REAL v) { REAL_REF *result; result = new REAL_REF; result->set_value ( v); return result; } #ifndef _BOOLEAN_REF_H BOOLEAN REAL_REF::_INFIX_LEQ ( REAL_REF* other) { return val < _REAL_REF_chk ( other, "other")->val ? _ert_BOOLEAN_Const ( true) : _ert_BOOLEAN_Const ( false); } REAL_REF* REAL_REF::_INFIX_ADD ( REAL_REF* other) { REAL_REF *r = new REAL_REF; r->val = _REAL_REF_chk ( other, "other")->val + val; return r; } REAL_REF* REAL_REF::_INFIX_SUB ( REAL_REF* other) { REAL_REF *r = new REAL_REF; r->val = _REAL_REF_chk ( other, "other")->val - val; return r; } REAL_REF* REAL_REF::_INFIX_MUL ( REAL_REF* other) { REAL_REF *r = new REAL_REF; r->val = _REAL_REF_chk ( other, "other")->val * val; return r; } REAL_REF* REAL_REF::_INFIX_DIV ( REAL_REF* other) { REAL_REF *r = new REAL_REF; r->val = _REAL_REF_chk ( other, "other")->val / val; return r; } #endif /* _BOOLEAN_REF_H */ BOOLEAN REAL_REF::_Conforms_to ( int other_id) /* Don't use REAL */ { if ( class_id == other_id) return true; #ifdef _BOOLEAN_REF_H { ANY a; return a._Conforms_to ( other_id); } #else { NUMERIC n; if ( n.class_id == other_id) return true; return n._Conforms_to ( other_id); } #endif } eon3122/bibt/bool_ref.H000644 000000 000001 00000002400 05710535116 015103 0ustar00rootother000000 000000 #ifndef _BOOLEAN_REF_H #define _BOOLEAN_REF_H class ANY; /* * * Non-expanded forms of basic type */ class BOOLEAN_REF : public virtual ANY { public: BOOLEAN val; BOOLEAN_REF(); virtual void set_value( BOOLEAN); virtual BOOLEAN item (); virtual STRING *out(); virtual void print( ANY *); virtual BOOLEAN_REF* _Clone (int, int, BOOLEAN_REF*); virtual BOOLEAN_REF* _localClone (int, int); virtual void _Copy ( int, int, BOOLEAN_REF*); BOOLEAN _Equal ( int, int, BOOLEAN_REF*); void* _rev_cvt ( int _type); BOOLEAN is_equal (BOOLEAN_REF*); BOOLEAN equal (ANY*, BOOLEAN_REF*); void copy ( BOOLEAN_REF*); BOOLEAN_REF* clone ( BOOLEAN_REF*); BOOLEAN deep_equal ( BOOLEAN_REF*, BOOLEAN_REF*); void deep_copy ( BOOLEAN_REF*); BOOLEAN_REF* deep_clone ( BOOLEAN_REF*); BOOLEAN _INFIX_LEQ ( BOOLEAN_REF*); BOOLEAN_REF* _INFIX_ADD ( BOOLEAN_REF*); BOOLEAN_REF* _INFIX_SUB ( BOOLEAN_REF*); BOOLEAN_REF* _INFIX_MUL ( BOOLEAN_REF*); BOOLEAN_REF* _INFIX_DIV ( BOOLEAN_REF*); BOOLEAN _Conforms_to ( int other_id); }; BOOLEAN_REF* _ert_clone_BOOLEAN ( BOOLEAN); BOOLEAN_REF* _ert_clone_BOOLEAN_REF ( BOOLEAN_REF *v); BOOLEAN_REF* _BOOLEAN_REF_chk ( BOOLEAN_REF*, char *); BOOLEAN_REF* _bibt_BOOLEAN_BOOLEAN_REF ( BOOLEAN); #endif /* _BOOLEAN_REF_H */ eon3122/bibt/char_ref.H000644 000000 000001 00000002532 05710535116 015073 0ustar00rootother000000 000000 #ifndef _CHARACTER_REF_H #define _CHARACTER_REF_H class ANY; /* * * Non-expanded forms of basic type */ class CHARACTER_REF : public virtual ANY { public: CHARACTER val; CHARACTER_REF(); virtual void set_value( CHARACTER); virtual CHARACTER item (); virtual STRING *out(); virtual void print( ANY *); virtual CHARACTER_REF* _Clone (int, int, CHARACTER_REF*); virtual CHARACTER_REF* _localClone (int, int); virtual void _Copy ( int, int, CHARACTER_REF*); BOOLEAN _Equal ( int, int, CHARACTER_REF*); void* _rev_cvt ( int _type); BOOLEAN is_equal (CHARACTER_REF*); BOOLEAN equal (ANY*, CHARACTER_REF*); void copy ( CHARACTER_REF*); CHARACTER_REF* clone ( CHARACTER_REF*); BOOLEAN deep_equal ( CHARACTER_REF*, CHARACTER_REF*); void deep_copy ( CHARACTER_REF*); CHARACTER_REF* deep_clone ( CHARACTER_REF*); BOOLEAN _INFIX_LEQ ( CHARACTER_REF*); CHARACTER_REF* _INFIX_ADD ( CHARACTER_REF*); CHARACTER_REF* _INFIX_SUB ( CHARACTER_REF*); CHARACTER_REF* _INFIX_MUL ( CHARACTER_REF*); CHARACTER_REF* _INFIX_DIV ( CHARACTER_REF*); BOOLEAN _Conforms_to ( int other_id); }; CHARACTER_REF* _ert_clone_CHARACTER ( CHARACTER); CHARACTER_REF* _ert_clone_CHARACTER_REF ( CHARACTER_REF *v); CHARACTER_REF* _CHARACTER_REF_chk ( CHARACTER_REF*, char *); CHARACTER_REF* _bibt_CHARACTER_CHARACTER_REF ( CHARACTER); #endif /* _CHARACTER_REF_H */ eon3122/bibt/dbl_ref.H000644 000000 000001 00000002323 05710535116 014715 0ustar00rootother000000 000000 #ifndef _DOUBLE_REF_H #define _DOUBLE_REF_H class ANY; /* * * Non-expanded forms of basic type */ class DOUBLE_REF : public virtual ANY { public: DOUBLE val; DOUBLE_REF(); virtual void set_value( DOUBLE); virtual DOUBLE item (); virtual STRING *out(); virtual void print( ANY *); virtual DOUBLE_REF* _Clone (int, int, DOUBLE_REF*); virtual DOUBLE_REF* _localClone (int, int); virtual void _Copy ( int, int, DOUBLE_REF*); BOOLEAN _Equal ( int, int, DOUBLE_REF*); void* _rev_cvt ( int _type); BOOLEAN is_equal (DOUBLE_REF*); BOOLEAN equal (ANY*, DOUBLE_REF*); void copy ( DOUBLE_REF*); DOUBLE_REF* clone ( DOUBLE_REF*); BOOLEAN deep_equal ( DOUBLE_REF*, DOUBLE_REF*); void deep_copy ( DOUBLE_REF*); DOUBLE_REF* deep_clone ( DOUBLE_REF*); BOOLEAN _INFIX_LEQ ( DOUBLE_REF*); DOUBLE_REF* _INFIX_ADD ( DOUBLE_REF*); DOUBLE_REF* _INFIX_SUB ( DOUBLE_REF*); DOUBLE_REF* _INFIX_MUL ( DOUBLE_REF*); DOUBLE_REF* _INFIX_DIV ( DOUBLE_REF*); BOOLEAN _Conforms_to ( int other_id); }; DOUBLE_REF* _ert_clone_DOUBLE ( DOUBLE); DOUBLE_REF* _ert_clone_DOUBLE_REF ( DOUBLE_REF *v); DOUBLE_REF* _DOUBLE_REF_chk ( DOUBLE_REF*, char *); DOUBLE_REF* _bibt_DOUBLE_DOUBLE_REF ( DOUBLE); #endif /* _DOUBLE_REF_H */ eon3122/bibt/int_ref.H000644 000000 000001 00000002436 05710535116 014753 0ustar00rootother000000 000000 #ifndef _INTEGER_REF_H #define _INTEGER_REF_H class ANY; /* * * Non-expanded forms of basic type */ class INTEGER_REF : public virtual ANY { public: INTEGER val; INTEGER_REF(); virtual void set_value( INTEGER); virtual INTEGER item (); virtual STRING *out(); virtual void print( ANY *); virtual INTEGER_REF* _Clone (int, int, INTEGER_REF*); virtual INTEGER_REF* _localClone (int, int); virtual void _Copy ( int, int, INTEGER_REF*); BOOLEAN _Equal ( int, int, INTEGER_REF*); void* _rev_cvt ( int _type); BOOLEAN is_equal (INTEGER_REF*); BOOLEAN equal (ANY*, INTEGER_REF*); void copy ( INTEGER_REF*); INTEGER_REF* clone ( INTEGER_REF*); BOOLEAN deep_equal ( INTEGER_REF*, INTEGER_REF*); void deep_copy ( INTEGER_REF*); INTEGER_REF* deep_clone ( INTEGER_REF*); BOOLEAN _INFIX_LEQ ( INTEGER_REF*); #ifndef _BOOLEAN_REF_H INTEGER_REF* _INFIX_ADD ( INTEGER_REF*); INTEGER_REF* _INFIX_SUB ( INTEGER_REF*); INTEGER_REF* _INFIX_MUL ( INTEGER_REF*); INTEGER_REF* _INFIX_DIV ( INTEGER_REF*); #endif BOOLEAN _Conforms_to ( int other_id); }; INTEGER_REF* _ert_clone_INTEGER ( INTEGER); INTEGER_REF* _ert_clone_INTEGER_REF ( INTEGER_REF *v); INTEGER_REF* _INTEGER_REF_chk ( INTEGER_REF*, char *); INTEGER_REF* _bibt_INTEGER_INTEGER_REF ( INTEGER); #endif /* _INTEGER_REF_H */ eon3122/bibt/real_ref.H000644 000000 000001 00000002171 05710535116 015100 0ustar00rootother000000 000000 #ifndef _REAL_REF_H #define _REAL_REF_H class ANY; /* * * Non-expanded forms of basic type */ class REAL_REF : public virtual ANY { public: REAL val; REAL_REF(); virtual void set_value( REAL); virtual REAL item (); virtual STRING *out(); virtual void print( ANY *); virtual REAL_REF* _Clone (int, int, REAL_REF*); virtual REAL_REF* _localClone (int, int); virtual void _Copy ( int, int, REAL_REF*); BOOLEAN _Equal ( int, int, REAL_REF*); void* _rev_cvt ( int _type); BOOLEAN is_equal (REAL_REF*); BOOLEAN equal (ANY*, REAL_REF*); void copy ( REAL_REF*); REAL_REF* clone ( REAL_REF*); BOOLEAN deep_equal ( REAL_REF*, REAL_REF*); void deep_copy ( REAL_REF*); REAL_REF* deep_clone ( REAL_REF*); BOOLEAN _INFIX_LEQ ( REAL_REF*); REAL_REF* _INFIX_ADD ( REAL_REF*); REAL_REF* _INFIX_SUB ( REAL_REF*); REAL_REF* _INFIX_MUL ( REAL_REF*); REAL_REF* _INFIX_DIV ( REAL_REF*); BOOLEAN _Conforms_to ( int other_id); }; REAL_REF* _ert_clone_REAL ( REAL); REAL_REF* _ert_clone_REAL_REF ( REAL_REF *v); REAL_REF* _REAL_REF_chk ( REAL_REF*, char *); REAL_REF* _bibt_REAL_REAL_REF ( REAL); #endif /* _REAL_REF_H */ eon3122/bibt/alias.dir000644 000000 000001 00000000077 05710535116 015004 0ustar00rootother000000 000000 COMPARABLE comparab.e CHARACTER char.e BOOLEAN_REF bool_ref.e eon3122/bibt/ert.cc000644 000000 000001 00000052042 05710535117 014314 0ustar00rootother000000 000000 // -*- C++ -*- #include #include #include #include #include #include #include #include #include #include #include #ifdef _TCC_ #include #include #endif #undef TRACE_STRING_CONSTANTS int _ert_trace_mode = 0; int _ert_debug_mode = 0; int _ert_trace_depth = 0; int _ert_signaled = 0; int _ert_expand = 0; int _ert_in_assertion = 0; int _ert_exitcode = 1; /* Set in except.e */ int _ert_depth = 0; _ERT_ENV _ert_cenv[_ERT_JMP_MAX]; static void _ert_global_error_handler(int); extern "C" { static int hash_string ( unsigned char*); INTEGER c_strcmp(POINTER,POINTER); char c_readchar(INTEGER); char* c_readline(INTEGER); INTEGER c_readint (int); REAL c_readreal(int); char* c_readstream(int,int); void c_next_line(int); void c_putint (INTEGER,INTEGER); INTEGER c_atoi ( POINTER); void c_itoa ( POINTER, INTEGER); void c_rtoa ( POINTER, REAL); void c_dtoa ( POINTER, DOUBLE); void c_btoa ( POINTER, BOOLEAN); int c_address_of ( POINTER); int c_file_open ( INTEGER, POINTER); POINTER c_alloc ( INTEGER); #ifdef _TCC_ int strlen ( char *); char *strcpy ( char *, char *); char *strcat ( char *, char *); int strcmp ( const char *, const char *); int memcpy ( char *, char *, int); int memcmp ( char *, char *, int); void memset ( char *, int, int); #endif }; void _fatal_signal ( int); typedef struct _S_ERT_CACHE_ { STRING* str; struct _S_ERT_CACHE_ *next; } _ERT_CACHE_; _ERT_CACHE_ * _ert_cache[MAX_CONST_STRINGS]; /* max. *cached* constant strings in system */ ARRAY* _ert_make_array (int elements, ...) { register i; static ARRAY* result; void* data; va_list ap; va_start ( ap, elements); result = new ARRAY; result->make ( 1, elements); for ( i = 1; i <= elements; i++) { data = va_arg ( ap, void*); result->put ( (ANY*)data, i); } va_end ( ap); return result; } ARRAY* _ert_make_array_from_nv ( int argc, char *argv[]) { register i; static ARRAY* result; STRING *str; result = new ARRAY; result->make ( 1, argc - 1); for ( i = 1; i < argc; i++) { str = _ert_new_string ( (POINTER)argv[i]); result->put ( (ANY*)str, i); } return result; } ANY* _ert_array_item ( POINTER area, INTEGER index) { ANY *p; void **DATA_PTR = (void **) area; p = (ANY*) DATA_PTR[index]; return p; } void _ert_array_put ( POINTER area, INTEGER index, ANY* data) { char **DATA_AREA = (char **) area; DATA_AREA[index] = (char *) data; } /* * I/O interface * * Several of these could be direct calls to the C library but there are * prototyping problems. */ INTEGER c_open ( POINTER file_name, INTEGER mode) { return open ( (char *) file_name, mode); } void c_close ( INTEGER fd) { close ( fd); } /* INTEGER c_read ( INTEGER fd, POINTER file_buffer, INTEGER len) { return read ( fd, file_buffer, len); } INTEGER c_write ( INTEGER fd, POINTER file_buffer, INTEGER len) { return write ( fd, file_buffer, len); } */ INTEGER c_strlen ( POINTER s) { return strlen ( (char*)s); } char c_item ( POINTER s, INTEGER i) { char* ptr; ptr = (char*)s; return ptr[i-1]; } void c_putstring ( INTEGER fd, POINTER buf) { char* s; s = (char*)buf; (void)write ( fd, s, strlen ( s)); } void c_putchar ( INTEGER fd, char c) { char c_buf[2]; sprintf ( c_buf, "%c", c); (void)write ( fd, c_buf, strlen ( c_buf)); } void c_putint ( INTEGER fd, INTEGER i) { char i_buf[12]; sprintf ( i_buf, "%d", i); (void)write ( fd, i_buf, strlen ( i_buf)); } void c_putreal ( INTEGER fd, float d) { char d_buf[30]; if ( d > 1000000.0) sprintf ( d_buf, "%g", d); else sprintf ( d_buf, "%f", d); (void)write ( fd, d_buf, strlen ( d_buf)); } void c_putdouble ( INTEGER fd, double d) { char d_buf[30]; if ( d > 1000000.0) sprintf ( d_buf, "%g", d); else sprintf ( d_buf, "%f", d); (void)write ( fd, d_buf, strlen ( d_buf)); } char c_readchar ( INTEGER fd) { char result[1]; read ( fd, result, 1); return result[0]; } static char _ert_input_buffer[1024]; char* c_readline ( INTEGER fd) { char c; int i; i = 0; do { if ( read ( fd, &c, 1) != 1) c = '\0'; else if ( c == '\n') c = '\0'; if ( c != '\0') _ert_input_buffer[i++] = c; } while ( i < sizeof(_ert_input_buffer) - 1 && c != '\n' && c != '\0'); _ert_input_buffer[i] = '\0'; return _ert_input_buffer; } int c_readint ( int fd) { int result; /* * this should use "PLATFORM.Integer_bits", and also do byte-swapping when * appropriate */ read ( fd, (char*)&result, sizeof ( result)); return result; } REAL c_readreal ( int fd) { REAL result; /* * this should use "PLATFORM.Real_bits", and also do byte-swapping when * appropriate */ read ( fd, (char*)&result, sizeof ( result)); return result; } DOUBLE c_readdouble ( int fd) { DOUBLE result; /* * this should use "PLATFORM.Double_bits", and also do byte-swapping when * appropriate */ read ( fd, (char*)&result, sizeof ( result)); return result; } char* c_readstream ( int fd, int len) { char c; int i; i = 0; do { if ( read ( fd, &c, 1) != 1) c = '\0'; else _ert_input_buffer[i++] = c; } while ( i < sizeof(_ert_input_buffer) && i < len && c != '\0'); _ert_input_buffer[i] = '\0'; return _ert_input_buffer; } void c_next_line ( int fd) { char c; do { if ( read ( fd, &c, 1) != 1) c = '\0'; } while ( c != '\n' && c != '\0'); } /* * Strings */ STRING* _ert_new_string ( POINTER s) { static STRING* result; CORE* core; int i, n, hashval; _ERT_CACHE_ *np; hashval = hash_string ( (unsigned char *) s); for ( np = _ert_cache[ hashval]; np; np = np->next) if ( !strcmp( (char *)s, (char *)np->str->space->space)) return np->str; result = new STRING; /* * * Theoretically, this routine could now call "result->make_from_c ( s)" to * set the value of the result string. But if assertion checking/tracing is * in use, then there is the danger that this routine will be called from the * argument display code, leading to infinite recursion. The solution here * is to access STRING's read-only (in Eiffel, anyway) attributes to perform * the same action as `make_from_c'. This is legal in C++ but not in Eiffel. */ /* * inline version of `make_from_c' */ n = strlen ( (char*)s); core = new CORE; core->allocate ( n+1); core->capacity = n + 1; c_strset ( core->space, s); result->space = core; np = (_ERT_CACHE_ *) malloc ( (unsigned int) sizeof( _ERT_CACHE_)); np->str = result; np->next = _ert_cache[hashval]; _ert_cache[hashval] = np; return result; } void c_strset ( POINTER tgt, POINTER src) { _eiffel_rt_Assert ( EXCEPT_PRECONDITION, "(eiffel_rt)", "valid destination", "c_strset", tgt != 0, _ert_longjmp()); _eiffel_rt_Assert ( EXCEPT_PRECONDITION, "(eiffel_rt)", "valid source", "c_strset", src != 0, _ert_longjmp()); (void)strcpy ( (char*)tgt, (char*)src); } void c_strcat ( POINTER tgt, POINTER src) { _eiffel_rt_Assert ( EXCEPT_PRECONDITION, "(eiffel_rt)", "valid source", "c_strcat", src != 0, _ert_longjmp()); _eiffel_rt_Assert ( EXCEPT_PRECONDITION, "(eiffel_rt)", "valid destination", "c_strcat", src != 0, _ert_longjmp()); (void)strcat ( (char*)tgt, (char*)src); } int c_file_open ( INTEGER mode, POINTER filename) { return open ( (char*)filename, mode); } INTEGER c_strcmp ( POINTER s1, POINTER s2) { return strcmp ( (const char*)s1, (const char*)s2); } INTEGER c_atoi ( POINTER sp) { return atoi ( (char *) sp); } void c_itoa ( POINTER sp, INTEGER value) { sprintf ( (char*)sp, "%d", value); } void c_rtoa ( POINTER sp, REAL value) { sprintf ( (char*)sp, "%f", value); } void c_dtoa ( POINTER sp, DOUBLE value) { sprintf ( (char*)sp, "%f", value); } void c_btoa ( POINTER sp, BOOLEAN value) { sprintf ( (char*)sp, "%s", value == true ? "true" : "false"); } int c_address_of ( POINTER sp) { return (int) sp; } POINTER c_alloc ( INTEGER nb) { static POINTER result; result = (POINTER)malloc ( nb); if ( result == 0) _ert_memory_error ( "c_alloc", nb); memset ( (char*)result, 0, nb); return result; } void c_free ( POINTER ptr) { free ( (char *) ptr); } void c_memcpy (POINTER tgt, POINTER src, INTEGER n) { memcpy ( (char *) tgt, (char*)src, n); } static int hash_string( unsigned char *s) { int hashval; for(hashval = 0; *s != '\0'; ) hashval += *s++; return hashval % MAX_CONST_STRINGS; } /* * If a POINTER type has been used as an attribute of a class, it can expect * to be _Clone'd. This presents a problem because we can generate the code * required to do it automatically (how long is the space it points to?). * We must fill in the implementation by hand. */ POINTER _ert_CORE_space_Copy ( CORE *cl) { POINTER p; p = (POINTER) c_alloc ( cl->capacity); memcpy ( (char *) p, (char *) cl->space, cl->capacity); return p; } POINTER _ert_GENERAL_c_object_address_Copy ( GENERAL *cl) { return (POINTER) cl; } POINTER _ert_GENERAL_c_class_name_Copy ( GENERAL *cl) { POINTER p; int l = strlen ( (char *) cl->c_class_name); p = c_alloc ( l + 1); memcpy ( (char *) p, (char *) cl->c_class_name, l); return p; } /* * Misc */ INTEGER _ert_errno() { extern int errno; return errno; } /* * Initialiasation * * _ert_initialise -- set-up Eiffel run-time environment */ void _ert_initialise( int trace_onoff, char *execname) { _ert_exception_init ( trace_onoff, execname); } void _ert_terminate ( int trace_onoff) { #ifdef _ERT_TRACE if ( trace_onoff) _ert_close_trace (); #endif } void _ert_set_exitcode(int code) { _ert_exitcode = code; } void _ert_set_trace_mode () { char *p; if ( (p = getenv ( "EON_TRACE")) != (char *) 0) _ert_trace_mode = atoi ( p); else _ert_trace_mode = 0; } void _ert_set_debug_mode () { if ( getenv ( "EON_DEBUG") != (char *) 0) _ert_debug_mode = 1; else _ert_debug_mode = 0; } _set_class_assert ( int assertions) { char *p; if ( (p = getenv ( "EON_ASSERT")) != (char *) 0) { if ( *p) assertions = 0; while ( *p) switch ( *p++) { case 'r': assertions |= A_REQUIRE; break; case 'e': assertions |= A_ENSURE; break; case 'i': assertions |= A_INVARIANT; break; case 'l': assertions |= A_LOOP; break; case 'c': assertions |= A_CHECK; break; case 'n': assertions |= A_NONE; break; case 'a': assertions |= A_ALL; break; } if ( assertions & A_ALL) assertions = A_REQUIRE | A_ENSURE | A_INVARIANT | A_LOOP | A_CHECK; else if ( assertions & A_NONE) assertions = 0; } return assertions; } POINTER _ert_object_address ( void* obj) { static char buf[12]; sprintf ( buf, "0x%x", (int)obj); return (POINTER)buf; } /* * BIBT Functions */ STRING* _bibt_CHARACTER_out ( CHARACTER c) { char buf[3]; sprintf ( buf, "%c", c); return _ert_new_string ( (POINTER)buf); } STRING* _bibt_INTEGER_out ( INTEGER i) { char buf[12]; sprintf ( buf, "%d", i); return _ert_new_string ( (POINTER)buf); } STRING* _bibt_REAL_out ( REAL r) { char buf[12]; sprintf ( buf, "%f", r); return _ert_new_string ( (POINTER)buf); } STRING* _bibt_DOUBLE_out ( DOUBLE r) { char buf[12]; sprintf ( buf, "%f", r); return _ert_new_string ( (POINTER)buf); } STRING* _bibt_NONE_out ( NONE n) { char buf[12]; sprintf ( buf, "0x%x", (int)&n); return _ert_new_string ( (POINTER)buf); } STRING* _bibt_POINTER_out ( POINTER n) { char buf[12]; sprintf ( buf, "0x%x", (int)&n); return _ert_new_string ( (POINTER)buf); } STRING* _bibt_BOOLEAN_out ( BOOLEAN b) { if ( b == true) return _ert_new_string ( (POINTER)"true"); return _ert_new_string ( (POINTER)"false"); } #ifdef OLD void * _ert_wrap_expr ( int idx, ...) { va_list ap; static int n[WRAP_MAX_ARGS]; static float f[WRAP_MAX_ARGS]; static double d[WRAP_MAX_ARGS]; int id; va_start ( ap, idx); id = va_arg ( ap, int); switch ( id) { case -7: /* REAL */ f[idx]= va_arg ( ap, double); /* NEEDS TO BE DOUBLE ?? */ return &f[idx]; case -8: /* DOUBLE */ d[idx] = va_arg ( ap, double); return &d[idx]; } va_end ( ap); return 0; } #endif #ifndef CHAR_MAX # include #endif /* * functions used in PLATFORM */ INTEGER _ert_char_size() { return sizeof ( CHARACTER) * 8; } INTEGER _ert_int_size() { return sizeof ( INTEGER) * 8; } INTEGER _ert_real_size() { return sizeof ( REAL) * 8; } INTEGER _ert_double_size() { return sizeof ( DOUBLE) * 8; } INTEGER _ert_ptr_size() { return sizeof ( POINTER) * 8; } INTEGER _ert_max_char() { return CHAR_MAX; } /**** **** Exceptions ****/ /* * Flags and things that are used in the exception scheme */ static BOOLEAN _ert_flag_assertion_violation; /* starts in unknown state */ static int except_modes[EXCEPT_MAX]; static int except_type; static void * except_addr; static char *except_class, *except_routine, *except_tag, *except_cond; int _ert_show_traceback = true; static int original_type = 0; static char *original_name = 0, *original_class = 0; static int show_trace_immediate = false; void _ert_show_trace_on_failure(void) { _ert_show_traceback = true; } void _ert_no_show_trace_on_failure(void) { _ert_show_traceback = false; } void _ert_show_trace(void) { show_trace_immediate = true; } void _ert_no_show_trace(void) { show_trace_immediate = false; } void _ert_except_mode ( int code, int mode) { if ( code > 0 && code < EXCEPT_BUILTIN) { switch ( mode) { case EXCEPT_CONTINUE: sigset ( code, _ert_global_error_handler); signals[code].ssr_mode = 1; break; case EXCEPT_IGNORE: sigset ( code, SIG_IGN); signals[code].ssr_mode = 0; break; case EXCEPT_CATCH: sigset ( code, _ert_global_error_handler); signals[code].ssr_mode = 0; break; } } except_modes[code + EXCEPT_OFFSET] = mode; } int _ert_except_status ( int code) { return except_modes [ code + EXCEPT_OFFSET]; } int _ert_original_exception(void) { return original_type; } STRING * _ert_last_exception_name () { static STRING *str = (STRING *) 0; if ( original_class) { if ( str == ( STRING *) 0) str = _ert_new_string ( original_class); else str->make_from_c ( original_class); } else str = (STRING *) 0; return str; } STRING * _ert_routine_name(void) { static STRING *str = (STRING *) 0; if ( original_name) { if ( str == ( STRING *) 0) str = _ert_new_string ( original_name); else str->make_from_c ( original_name); } else str = (STRING *) 0; return str; } STRING * _ert_tag_name(void) { static STRING *str = (STRING *) 0; if ( except_tag) { if ( str == ( STRING *) 0) str = _ert_new_string ( except_tag); else str->make_from_c ( except_tag); } else str = (STRING *) 0; return str; } STRING * _ert_void_call_target(void) { static STRING *str = (STRING *) 0; return str; } /* * This is in the runtime rather than in the class code because g++ core-dumps * if longjmp() and setjmp() are in the function. It also make the invariant * assertion marginaly easier. */ void _ert_longjmp() { if ( _ert_depth) longjmp ( _ert_cenv[ _ert_depth - 1].jmpenv, 1); } int _ert_last_exception() { return except_type; } BOOLEAN _ert_assertion_violation() { return _ert_flag_assertion_violation; } void _ert_reset_all_default() /* Reset exception handlers */ { _ert_exception_init( 0, 0); } void _ert_reset_default(int code) /* Reset exception handler for `code'*/ { if ( signals[code].ssr_catch) { sigset ( code, _ert_global_error_handler); signals[code].ssr_mode = 1; } except_modes[code + EXCEPT_OFFSET] = EXCEPT_CATCH; } void _ert_exception_init( int trace_onoff, char *exec_name) { register i; /* * Don't confuse this with the eiffel Caught/Ignored thing. * This overrides signals() settings determined by the calling shell. */ for ( i = 0; i < sizeof ( signals)/sizeof ( struct sig_table); i++) if ( signals[i].ssr_catch) { sigset ( i, _ert_global_error_handler); signals[i].ssr_mode = 1; } for ( i = 0; i < EXCEPT_MAX + EXCEPT_OFFSET; i++) except_modes[i] = EXCEPT_CATCH; #ifdef _ERT_TRACE if ( trace_onoff) _ert_open_trace ( exec_name); #endif } /* * Raise an exception from a violated assertion or some non-user-specified * exception */ void _ert_trace_log ( char *rec_class, char *rec_routine, int rcode, int depth) { _trace_write_log ( rec_class, rec_routine, except_addr, except_type, except_class, except_routine, except_tag, except_cond, rcode, depth); if ( rcode == EXCEPT_FAIL) { if ( !original_type) { original_type = except_type; original_name = except_routine; original_class = except_class; } } else original_type = 0, original_class = original_name = 0; } void _ert_raise ( int type, char *class_name, char *routine, char *tag, char *cond) { except_type = type; /* Record so the can be logged */ #ifdef _ERT_TRACE except_class = class_name; /* by the routine receiving */ except_routine = routine; /* the exception */ except_tag = tag; except_cond = type == EXCEPT_ROUTINE_FAILURE ? 0 : cond; except_addr = (void*) _ert_cenv[ _ert_depth - 1].caddr; #endif if ( type < 0) { if ( except_modes[ type * -1] == EXCEPT_IGNORE) return; } else { if ( except_modes[ type + EXCEPT_OFFSET] == EXCEPT_IGNORE) return; } if ( show_trace_immediate) { if ( class_name) printf ( "Exception(%d): \"%s.%s\": %s %s %s\n", type, class_name, routine, _ert_except_mesg ( type)->to_c(), tag ? tag : "", cond ? cond : ""); else printf ( "Signal: \"%s\" %s\n", tag, cond); } switch ( type) { case EXCEPT_PRECONDITION: case EXCEPT_POSTCONDITION: case EXCEPT_INVARIANT: _ert_flag_assertion_violation = true; break; default: _ert_flag_assertion_violation = false; break; } } void _ert_raise_developer_exception(int code) { _ert_raise ( code, "", "", 0, 0); _ert_depth -= 2; /* This is a cheat becuase we know we are two */ _ert_longjmp (); /* routines deep */ } STRING * _ert_except_mesg ( int n) { char tmp[25], *m; static STRING *str = (STRING *) 0; switch ( n) { case EXCEPT_PRECONDITION: m = "Precondition"; break; case EXCEPT_POSTCONDITION: m = "Postcondition"; break; case EXCEPT_INVARIANT: m = "Class invariant"; break; case EXCEPT_LOOP_INVARIANT: m = "Loop invariant"; break; case EXCEPT_LOOP_VARIANT: m = "Loop variant"; break; case EXCEPT_ROUTINE_FAILURE: m = "Routine failure"; break; case EXCEPT_VOID_TARGET_CALL: m = "Void target call"; break; case EXCEPT_NO_MORE_MEMORY: m = "No more memory"; break; case EXCEPT_CALL_TO_DEFERRED: m = "Call to deferred feature"; break; case EXCEPT_BAD_SIGNAL: m = "Bad signal number"; break; case EXCEPT_NESTED_FUNCTIONS: m = "Too many nested functions"; break; case EXCEPT_INSPECTION_VALUE: m = "Untrapped inspect value"; break; case EXCEPT_ASSIGNED_TO_EXPANDED: m = "Assignment of void to an expanded entity"; break; case EXCEPT_ARRAY_TYPE_ERROR: m = "Assignment of ARRAY[ANY].item to wrong type"; break; case EXCEPT_RESCUE_FAILED: m = "Failure in rescue clause (check last code)"; break; default: if ( n < 0) sprintf ( m = tmp, "Developer exception (%d)", n); else if ( n < EXCEPT_BUILTIN) sprintf ( m = tmp, "Signal (%d)", n); else sprintf ( m = tmp, "Unknown exception (%d)", n); break; } if ( m) { if ( str == ( STRING *) 0) str = _ert_new_string ( m); else str->make_from_c ( m); } else str = (STRING *) 0; return str; } static void _ert_global_error_handler(int n) { _ert_raise ( n, 0, 0, signals[n].desc, signals[n].name); _ert_signaled = n; #ifdef NO_SAFE_SIGNALS signal ( n, _ert_global_error_handler); #endif #ifdef HAS_LONGJMP if ( signals[n].ssr_mode) { sigset ( n, _ert_global_error_handler); longjmp ( _ert_cenv[ _ert_depth - 1].jmpenv, 1); } #else _fatal_signal ( n); #endif } /* * Signals * These declarations don't seem to stay the same for more than a few minutes. * */ void _fatal_signal ( int sig) { printf ( "*** Fatal Signal %s (%s) received\n", signals[sig].name, signals[sig].desc); printf ( "Eiffel call-stack (for monitored routines):\n"); _trace_back(1); } void _ert_memory_error ( char* in_routine, int request) { fprintf ( stderr, "*** Memory allocation error in `%s' (%d bytes)\n", in_routine, request); _trace_back(1); } /* * Numerical functions */ INTEGER _ert_INTEGER_POW(double base, int n) { register i; int p = 1; for ( i = 0; i < n; i++) p = p * (INTEGER) base; return p; } REAL _ert_REAL_POW(double base, int n) { register i; REAL p = 1.0; for ( i = 0; i < n; i++) p = p * (REAL) base; return p; } DOUBLE _ert_DOUBLE_POW(double base, int n) { register i; DOUBLE p = 1.0; for ( i = 0; i < n; i++) p = p * (DOUBLE) base; return p; } eon3122/bibt/tracb.cc000644 000000 000001 00000023115 05710535120 014606 0ustar00rootother000000 000000 #include #include #include #include struct call_frame { void* object; char* class_name; char* routine; struct call_args* args; }; struct call_args* new_arg ( char*, char*, int); struct call_frame* new_call_frame ( void*, char*, char*, struct call_args*); void print_args_list ( FILE *fp, struct call_args*); void free_args ( struct call_args*); extern "C" { char *_ert_traceback_map ( void *, int); #if !defined ( _DJGPP_) && !defined ( _TCC_) char *getenv(char *); #endif #ifdef _TCC_ #include #include int strlen ( char *); char *strcpy ( char *, char *); int strcmp ( char *, char *); int memcpy ( char *, char *, int); int memcmp ( char *, char *, int); #endif } static struct call_frame* frameblk[_ERT_JMP_MAX]; static int trace_guard = 0; static long TraceRetry = -1l; static FILE *ExceptFp = NULL; static char *_execname; void _ert_open_trace( char *execname) { char *pt, *p; #ifdef MSDOS register i; char *cptr; char namebuf[80]; #endif pt = execname + strlen ( execname); while ( pt > execname) { if ( *pt == '/' || *pt == PATH_SEP_CHAR) { execname = pt + 1; break; } pt--; } if ( !( p = getenv ( "EON_TMP"))) p = TMP_DIR; pt = (char *) malloc ( strlen ( p) + strlen ( execname) + strlen ( TRACE_EXT) + 2); strcpy ( pt, p); #ifdef MSDOS for ( cptr = (char*)(execname+strlen(execname)-1); cptr >= execname && (*cptr != '\\' && *cptr != '/'); cptr--) ; if ( cptr > execname) strcpy ( namebuf, cptr+1); else strcpy ( namebuf, execname); for ( cptr = namebuf; *cptr && *cptr != '.'; cptr++) ; if ( *cptr) *cptr = '\0'; sprintf ( pt + strlen ( pt), "%c%s%s", PATH_SEP_CHAR, namebuf, TRACE_EXT); #else sprintf ( pt + strlen ( pt), "%c%s%s", PATH_SEP_CHAR, execname, TRACE_EXT); #endif _execname = (char *) malloc ( strlen ( pt) + 1); strcpy ( _execname, pt); free ( pt); } void _ert_close_trace() { if ( ExceptFp) { fprintf ( ExceptFp, "\nProgram terminated (full exception listing in \"%s\").\n", _execname); fclose ( ExceptFp); } } void _trace_write_log ( char *rec_class, char *rec_routine, void* addr, int type, char *class_name, char *routine, char *tag, char *cond, int rcode, int depth) { register i; if ( !ExceptFp) { if ( ( ExceptFp = fopen ( _execname, "w")) == NULL) { fprintf ( stderr, "Unable to open exception log \"%s\".\n", _execname); exit ( 1); } fprintf ( ExceptFp, "\n"); for ( i = 0; i < 79; i++) fprintf ( ExceptFp, "-"); fprintf ( ExceptFp, "\n"); /* 123456789_123456789_123456789_123456789_123456789_123456789_123456789_123456789 */ fprintf ( ExceptFp, "Object Class Routine Nature of exception Effect\n"); for ( i = 0; i < 79; i++) fprintf ( ExceptFp, "="); fprintf ( ExceptFp, "\n\n"); } fprintf ( ExceptFp, "%08lx %-17.17s %-20.20s %-25.25s %s\n", (long) addr, rec_class, rec_routine, _ert_except_mesg ( type)->to_c (), rcode == EXCEPT_RETRY ? "Retry" : " Fail"); if ( class_name && (strcmp ( class_name, rec_class) || strcmp ( routine, rec_routine))) { fprintf ( ExceptFp, " (from %.11s.%s)\n", class_name || !depth || !frameblk[depth] ? class_name : frameblk[depth]->class_name, class_name || !depth || !frameblk[depth] ? routine : frameblk[depth]->routine); } if ( cond) fprintf ( ExceptFp, "%s: %s\n", tag ? tag : "", cond); if ( _ert_depth > 1 && frameblk[depth]) print_args_list ( ExceptFp, frameblk[depth]->args); if ( rcode == EXCEPT_FAIL) { for ( i = 0; i < 79; i++) fprintf ( ExceptFp, "-"); fprintf ( ExceptFp, "\n"); } else { for ( i = 0; i < 79; i++) fprintf ( ExceptFp, "="); fprintf ( ExceptFp, "\n"); if ( rcode == EXCEPT_RETRY) TraceRetry = ftell ( ExceptFp); } fflush ( ExceptFp); } struct call_args* _make_arg_list (char *begin, ...) { static struct call_args* result; struct call_args *ptr = 0, *optr = 0; va_list ap; char *start, *name; void *val; int formal_id; if ( trace_guard) return 0; va_start ( ap, begin); start = begin; if ( !start) { va_end ( ap); return 0; } trace_guard++; result = 0; while ( 1) { val = va_arg ( ap, void*); formal_id = va_arg ( ap, int); ptr = new_arg ( start, (char *) val, formal_id); if ( result == 0) result = ptr; else optr->next = ptr; optr = ptr; start = va_arg ( ap, char*); if ( start == 0) break; } va_end ( ap); trace_guard--; if ( _ert_trace_mode > 2) print_args_list ( stdout, result); return result; } void _enter_routine ( void *object, char* class_name, char* rtn_name, struct call_args* args) { frameblk[_ert_depth] = new_call_frame ( object, class_name, rtn_name, args); } void free_call_frame ( struct call_frame* frame) { if ( frame != 0) { if ( frame->class_name != 0) free ( frame->class_name); if ( frame->routine != 0) free ( frame->routine); if ( frame->args != 0) free_args ( frame->args); free ( frame); } } void _leave_routine() { struct call_frame* ptr; if ( _ert_depth) { free_call_frame ( frameblk[_ert_depth]); frameblk[_ert_depth] = 0; } } struct call_frame* new_call_frame ( void* object, char* class_name, char* name, struct call_args* args) { static struct call_frame* result; result = (struct call_frame*) malloc ( sizeof ( struct call_frame)); if ( result == 0) _ert_memory_error ( "new_call_frame", sizeof ( struct call_frame)); if ( class_name && strlen ( class_name)) { result->class_name = (char*) malloc ( strlen ( class_name) + 1); if ( result == 0) _ert_memory_error ( "new_call_frame", strlen ( class_name) + 1); strcpy ( result->class_name, class_name); } else result->class_name = 0; if ( name && strlen ( name)) { result->routine = (char*) malloc ( strlen ( name) + 1); if ( result == 0) _ert_memory_error ( "new_call_frame", strlen ( name) + 1); strcpy ( result->routine, name); } else result->routine = 0; result->object = object; result->args = args; return result; } struct call_args* new_arg ( char* name, char* data, int formal_id) { static struct call_args* result; char *val; if ( !data) val = ""; else if ( !formal_id || !memcmp ( data, "?", 2)) val = "?"; else val = _ert_traceback_map ( (void *) data, formal_id); result = (struct call_args*) malloc ( sizeof ( struct call_args)); if ( result == 0) _ert_memory_error ( "new_arg", sizeof ( struct call_args)); if ( name && strlen(name)) { result->arg_name = (char*) malloc ( strlen ( name) + 1); if ( result == 0) _ert_memory_error ( "new_arg", strlen ( name) + 1); strcpy ( result->arg_name, name); } else result->arg_name = 0; if ( val && strlen(val)) { result->arg_value = (char*) malloc ( strlen ( val) + 1); if ( result == 0) _ert_memory_error ( "new_arg", strlen ( val) + 1); strcpy ( result->arg_value, val); } else result->arg_value = 0; result->next = 0; return result; } /* void print_routine ( struct call_frame* fp) { fprintf ( stderr, "-------------------------------------------------------------------------------\n"); fprintf ( stderr, "0x%08lx %-12s %-15s ", fp->object, fp->class_name, fp->routine); print_args_list ( ExceptFp, fp->args); fprintf ( stderr, "\n"); } */ void _trace_back ( int mode) { register i; int ch; if ( _ert_show_traceback == false) return; if ( !mode) { fprintf ( stderr, "No traceback available\n"); exit ( 1); } fflush ( stdout); if ( ( ExceptFp = fopen ( _execname, "r")) == NULL) { fprintf ( stderr, "No traceback available - Can't open file \"%s\"\n", _execname); exit ( 1); } i = 0; while ( i < 4) { if ( (ch = fgetc ( ExceptFp)) == EOF) break; fputc ( ch, stderr); if ( ch == '\n') i++; } if ( TraceRetry != -1l) fseek ( ExceptFp, TraceRetry, 0); while ( (ch = fgetc ( ExceptFp)) != EOF) fputc ( ch, stderr); fclose ( ExceptFp); exit ( 1); } void free_args ( struct call_args* list) { struct call_args* ptr; ptr = list; while ( ptr != 0) { struct call_args* optr = ptr->next; if ( ptr->arg_name != 0) free ( ptr->arg_name); if ( ptr->arg_value != 0) free ( ptr->arg_value); free ( ptr); ptr = optr; } } void print_args_list ( FILE *fp, struct call_args* list) { struct call_args* ptr; register char *t; register i; char buf[80], *x = "Parameter list:"; int l, l1; if ( !list) return; l = strlen ( x); ptr = list; while ( ptr != 0) { l1 = strlen ( ptr->arg_name ? ptr->arg_name : "???") + 3; if ( ptr->arg_value != 0) { t = ptr->arg_value; for ( i = 0; i < 79; i++, t++) buf[i] = *t == '\n' ? '^' : *t; buf[i] = '\0'; l1 += strlen ( buf) + 2; } else l1 += 6; if ( l1 > l) l = l1; ptr = ptr->next; } l = 79 - l; if ( l > 48) l = 48; for ( i = 0; i < l; i++) fprintf ( fp, " "); fprintf ( fp, "%s\n", x); ptr = list; while ( ptr != 0) { for ( i = 0; i < l; i++) fprintf ( fp, " "); fprintf ( fp, "%s = ", ptr->arg_name ? ptr->arg_name : "???"); if ( ptr->arg_value != 0) { t = ptr->arg_value; for ( i = 0; i < 79; i++, t++) buf[i] = *t == '\n' ? '^' : *t; buf[i] = '\0'; fprintf ( fp, "\"%s\"", buf); } else fprintf ( fp, ""); fprintf ( fp, "\n"); ptr = ptr->next; } } eon3122/bibt/ert.H000644 000000 000001 00000025544 05710535117 014125 0ustar00rootother000000 000000 #ifndef _EIFFEL_RT_H #define _EIFFEL_RT_H /*************************************************************************** * * Configuration section * ***************************************************************************/ #ifdef __linux__ extern "C" { /* * Hard code in these declarations. The correct thing to do would be to * include but this file include definitions that cause other * problems */ int open (char *, int); int close (int); int read (int, char *, int); int write (int, char *, int); char *strcat (char *, char *); void memset (char *, int, int); } #endif /* * Enable tracing in the runtime. If tracb.C is to be removed from the * runtime system, comment this out. * WARNING - Untested */ #define _ERT_TRACE /* * The depth of nested function calls */ #define _ERT_JMP_MAX 96 /* * The runtime system supports a method of caching equal string constants * together. If your application uses a lot of strings you can increase * this value for a better performance (but it won't make a great difference) */ #define MAX_CONST_STRINGS 300 /* * Configuration for exception handling. Determined by C++ compiler limits */ #define HAS_LONGJMP /* longjmp implemented */ #if defined (__linux__) #define sigset signal #endif #ifdef _DJGPP_ #define sigset signal #endif #ifdef _EMX_ #define sigset signal #endif #ifdef _TCC_ #include #define sigset signal #if defined (BORLAND_SIGNAL_BUG) && defined ( SIG_IGN) #undef SIG_IGN typedef void _Cdecl (* _CatcherPTRcpp)(int); #define SIG_IGN ((_CatcherPTRcpp)1) /* Ignore action */ #endif #endif #ifdef _BCC_ #define sigset signal #if defined (BORLAND_SIGNAL_BUG) && defined ( SIG_IGN) #undef SIG_IGN typedef void _Cdecl (* _CatcherPTRcpp)(int); #define SIG_IGN ((_CatcherPTRcpp)1) /* Ignore action */ #endif #endif /* * If the preprocess is capable of coercing arguments with the `#' operator * set _SMART_CPP_. This passes the failing conditional of an assertion to * be displayed in the traceback. */ #if defined(__GNUC__) #define _SMART_CPP_ #endif /* * This is a bit of a problem. We have to hard code the id's of the REF * classes. If these class are removed, the next time a system is built * they will be inserted in the wrong place (probably). * */ #define _bibt_BOOLEAN_REF_id 9 #define _bibt_CHARACTER_REF_id 10 #define _bibt_INTEGER_REF_id 11 #define _bibt_REAL_REF_id 12 #define _bibt_DOUBLE_REF_id 13 /*************************************************************************** * * End of configuration section. Change anything below at your peril. * ***************************************************************************/ #ifdef _SMART_CPP_ #define _eiffel_rt_Assert(TYPE,CLASS,RTN,TAG,EX,RESC) if (EX) /* TAG */ ; \ else { _ert_raise ( TYPE, CLASS, RTN, TAG, #EX); RESC; } #else #define _eiffel_rt_Assert(TYPE,CLASS,RTN,TAG,EX,RESC) if (EX) /* TAG */ ; \ else { _ert_raise ( TYPE, CLASS, RTN, TAG, 0); RESC; } #endif #define A_REQUIRE 0x0001 /* 'r' */ /* Copied from beth.c */ #define A_ENSURE 0x0002 /* 'e' */ #define A_INVARIANT 0x0004 /* 'i' */ #define A_LOOP 0x0008 /* 'l' */ #define A_CHECK 0x0010 /* 'c' */ #define A_ALL 0x0020 /* 'a' */ #define A_NONE 0x0040 /* 'n' */ int _set_class_assert ( int); /* * These re-map the terser C++ compiler #defines into the ones used in the * generated code */ /* * Problem here... Must be defined unless the entire system is optimised */ #define EA_INVARIANT #ifndef EON_O #define NO_OPTIMISATION #endif // EON_O #ifdef EON_T #define EIFFEL_TRACE #endif // EON_T #ifdef EON_E #define EA_ENSURE #endif #ifdef EON_R #define EA_REQUIRE #endif #ifdef EON_I #define EA_INVARIANT #endif #ifdef EON_L #define EA_LOOP_INVARIANT #define EA_LOOP_VARIANT #endif #ifdef EON_C #define EA_CHECK #endif #ifdef NEEDS_BOOL enum bool { false=0, true=1 }; #endif #define MAX_ROUTINE_NAME_LEN 30 /* Also in cdb/eon_tables.h - don't change */ /* * implementation-depeandant values: */ #define BYTE_SIZE 8 /* * aliasing for basic types (BIBT) */ #define CHARACTER char #define INTEGER int #define REAL float #define DOUBLE double #define BOOLEAN bool #define BIT void* #define NONE void* #define POINTER void* #define _ert_init_CHARACTER 0 #define _ert_init_INTEGER 0 #define _ert_init_REAL 0.0 #define _ert_init_DOUBLE 0.0 #define _ert_init_BOOLEAN "false" #define _ert_init_BIT 0 #define _ert_init_POINTER (void*) 0 class GENERAL; class ANY; class STRING; class ARRAY; class CORE; #define Current this /* #define WRAP_MAX_ARGS 16 typedef union { int Wi; double Wd; } _ert_Wrap; */ /* #define AND_THEN(e1,e2) (e1)?(e2):0 */ #define _ert_BOOLEAN_AND_THEN(e1,e2) ((e1)&&(e2)) #define _ert_BOOLEAN_OR_ELSE(e1,e2) ((e1)?1:(e2)) #define _ert_BOOLEAN_XOR(e1,e2) _ert_BOOLEAN_Const ( (((e1)?(!(e2)):(e2)) ? "true" : "false")) #define _ert_BOOLEAN_IMPLIES(e1,e2) ((e1)?(e2):1) #define _ert_INTEGER_IMPLIES(e1,e2) (INTEGER) ((e1)?(e2):1) #define _ert_REAL_IMPLIES(e1,e2) (REAL) ((e1)?(e2):1) #define _ert_DOUBLE_IMPLIES(e1,e2) (DOUBLE) ((e1)?(e2):1) #define _ert_INTEGER_IDIV(e1,e2) ((int) (e1/e2)) /* * Copy constructors for built-in types: */ #define _ert_INTEGER_Const(ip) ((INTEGER)(ip)) #define _ert_REAL_Const(rp) ((REAL)(rp)) #define _ert_DOUBLE_Const(rp) ((DOUBLE)(rp)) #define _ert_NONE_Const(vp) ((NONE)(vp)) #define _ert_POINTER_Const(ptr) ((POINTER)(ptr)) #define _ert_BOOLEAN_Const(bp) ((BOOLEAN)(bp)) #define _ert_CHARACTER_Const(cp) ((CHARACTER)(cp)) #define _ert_INTEGER_Copy(ip) ((INTEGER)(ip)) #define _ert_REAL_Copy(rp) ((REAL)(rp)) #define _ert_DOUBLE_Copy(rp) ((DOUBLE)(rp)) #define _ert_NONE_Copy(vp) ((NONE)(vp)) #define _ert_POINTER_Copy(ptr) ((POINTER)(ptr)) #define _ert_BOOLEAN_Copy(bp) ((BOOLEAN)(bp)) #define _ert_CHARACTER_Copy(cp) ((CHARACTER)(cp)) #define _ert_INTEGER_Equal(selfp,ip) ((selfp)==(ip)) #define _ert_REAL_Equal(selfp,rp) ((selfp)==(rp)) #define _ert_DOUBLE_Equal(selfp,rp) ((selfp)==(rp)) #define _ert_NONE_Equal(selfp,vp) ((selfp)==(vp)) #define _ert_POINTER_Equal(selfp,ptr) ((selfp)==(ptr)) #define _ert_BOOLEAN_Equal(selfp,bp) ((selfp)==(bp)) #define _ert_CHARACTER_Equal(selfp,cp) ((selfp)==(cp)) extern "C" { int c_open ( POINTER, INTEGER); void c_close ( INTEGER); void c_putstring ( INTEGER,POINTER); void c_putint ( INTEGER, INTEGER); void c_putreal ( INTEGER, float); void c_putdouble ( INTEGER, double); void c_putchar ( INTEGER, char); INTEGER c_atoi ( POINTER); void c_itoa ( POINTER, INTEGER); void c_memcpy ( POINTER, POINTER, INTEGER); void c_free ( POINTER); int printf ( const char* ...); STRING* _ert_new_string(POINTER); void _ert_initialise( int, char*); void _ert_terminate ( int); void _ert_set_exitcode(int); void *_ert_wrap_expr ( int, ...); void _ert_array_put ( POINTER, INTEGER, ANY*); ARRAY* _ert_make_array ( int, ...); ARRAY *_ert_make_array_from_nv ( int, char**); ARRAY *_ert_make_array_from_v ( char *envp[]); POINTER _ert_object_address ( NONE); POINTER _ert_to_c(); STRING* _bibt_CHARACTER_out ( CHARACTER); STRING* _bibt_INTEGER_out ( INTEGER); STRING* _bibt_BOOLEAN_out ( BOOLEAN); STRING* _bibt_REAL_out ( REAL); STRING* _bibt_DOUBLE_out ( REAL); STRING* _bibt_NONE_out ( NONE); STRING* _bibt_POINTER_out ( POINTER); char* _bibt_CHARACTER_save ( char *); char* _bibt_INTEGER_save ( int); char* _bibt_BOOLEAN_save ( char *); char* _bibt_REAL_save ( float); char* _bibt_DOUBLE_save ( double); char* _bibt_NONE_save ( void *); char* _bibt_POINTER_save ( char *); INTEGER _ert_char_size(); INTEGER _ert_int_size(); INTEGER _ert_real_size(); INTEGER _ert_double_size(); INTEGER _ert_ptr_size(); INTEGER _ert_max_char(); POINTER _ert_CORE_space_Copy ( CORE *); POINTER _ert_GENERAL_c_class_name_Copy ( GENERAL *); POINTER _ert_GENERAL_c_object_address_Copy ( GENERAL *); void _ert_longjmp(); void _ert_raise ( int, char*, char*, char*, char*); BOOLEAN _ert_assertion_violation(); void _ert_exception_init(int, char*); STRING *_ert_except_mesg (int); void *_base2obj ( ANY *, int); void _ert_memory_error ( char*, int); void _trace_write_log ( char*, char*, void *, int, char*, char*, char*, char*, int, int); void _ert_trace_log ( char *, char *, int, int); void _ert_no_show_trace_on_failure(void); void _ert_show_trace_on_failure(void); int _ert_original_exception(void); STRING *_ert_routine_name(void); STRING *_ert_tag_name(void); STRING *_ert_void_call_target(void); void _ert_show_trace(void); void _ert_no_show_trace(void); void _ert_raise_developer_exception(int); INTEGER _ert_INTEGER_POW(double,int); REAL _ert_REAL_POW(double,int); DOUBLE _ert_DOUBLE_POW(double,int); } /* * Defined in C++ */ extern int _ert_trace_depth; extern int _ert_debug_depth; extern int _ert_trace_mode; extern int _ert_signaled; extern int _ert_show_traceback; extern int _ert_expand; extern int _ert_exitcode; extern int _ert_rescuing; extern int _ert_in_assertion; void _ert_set_trace_mode(); void _ert_set_debug_mode(); #ifdef _ERT_TRACE #include "tracb.H" #endif #include #include typedef struct { jmp_buf jmpenv; void *caddr; } _ERT_ENV; extern int _ert_depth; extern _ERT_ENV _ert_cenv[_ERT_JMP_MAX]; /* * Well known exception conditions * These are duplicated in ec2.h * * If you add a new EXCEPT_ type change: * ert.C _ert_raise() if it is an assertion. * ert.C _ert_except_mesg() */ #define EXCEPT_BUILTIN 100 /* Start of Assertions */ #define EXCEPT_PRECONDITION 100 #define EXCEPT_POSTCONDITION 101 #define EXCEPT_INVARIANT 102 #define EXCEPT_LOOP_INVARIANT 103 #define EXCEPT_LOOP_VARIANT 104 #define EXCEPT_CHECK_INSTRUCTION 105 /* These are grouped as Assertions */ #define EXCEPT_ROUTINE_FAILURE 106 #define EXCEPT_VOID_TARGET_CALL 107 #define EXCEPT_NO_MORE_MEMORY 108 #define EXCEPT_CALL_TO_DEFERRED 109 #define EXCEPT_BAD_SIGNAL 110 #define EXCEPT_NESTED_FUNCTIONS 111 #define EXCEPT_INSPECTION_VALUE 112 #define EXCEPT_ASSIGNED_TO_EXPANDED 113 #define EXCEPT_ARRAY_TYPE_ERROR 114 #define EXCEPT_RESCUE_FAILED 115 #define EXCEPT_MAX 115 /* Same as last EXCEPT_... */ #define EXCEPT_IGNORE 1 #define EXCEPT_CATCH 2 #define EXCEPT_CONTINUE 3 #define EXCEPT_DEVELOPER_1 -1 #define EXCEPT_DEVELOPER_2 -2 #define EXCEPT_DEVELOPER_3 -3 #define EXCEPT_DEVELOPER_4 -4 #define EXCEPT_DEVELOPER_5 -5 #define EXCEPT_OFFSET 5 /* the number of developer exceptions */ #define EXCEPT_RETRY 1 #define EXCEPT_FAIL 2 /* * Signal compatibility * * This is a messy area because MSDOS doesn't support full Unix signals * and different vendors have different include files. * * Here, we attempt to plug a few holes. */ #ifdef MSDOS #ifdef _DJGPP_ #ifndef SIGUSR1 #define SIGUSR1 30 #define SIGUSR2 31 #endif #endif /* * A few platform dependant bits */ #define PATH_SEP_CHAR '\\' #else /* MSDOS */ #define PATH_SEP_CHAR '/' #endif /* MSDOS */ #endif /* _EIFFEL_RT_H */ eon3122/bibt/sigtable.h000644 000000 000001 00000002670 05710535120 015152 0ustar00rootother000000 000000 struct sig_table { char* name; char* desc; int ssr_catch; void (*ssr)(...); int ssr_mode; }; struct sig_table signals[] = { { "BADSIG", "Signal 0 not defined", 0, 0, 0 }, { "SIGHUP", "Hangup", 1, 0, 0 }, { "SIGINT", "Interrupt (rubout)", 1, 0, 0 }, { "SIGQUIT", "Quit (ASCII FS)" , 0, 0, 0 }, { "SIGILL", "Illegal instruction (not reset when caught" , 0, 0, 0 }, { "SIGTRAP", "Trace trap (not reset when caught)" , 0, 0, 0 }, { "SIGIOT/SIGABRT", "IOT instruction/Abort" , 0, 0, 0 }, { "SIGEMT", "EMT instruction", 0, 0, 0 }, { "SIGFPE", "Floating point exception", 0, 0, 0 }, { "SIGKILL", "Kill (cannot be caught or ignored)" , 0, 0, 0 }, { "SIGBUS", "Bus error" , 0, 0, 0 }, { "SIGSEGV", "Segmentation violation" , 0, 0, 0 }, { "SIGSYS", "Bad argument to system call" , 0, 0, 0 }, { "SIGPIPE", "Write on a pipe with no one to read it", 1, 0, 0 }, { "SIGALRM", "Alarm clock", 1, 0, 0 }, { "SIGTERM", "Software termination signal from kill" , 1, 0, 0 }, { "SIGUSR1", "User defined signal 1" , 1, 0, 0 }, { "SIGUSR2", "User defined signal 2" , 1, 0, 0 }, { "SIGCLD", "Death of a child" , 1, 0, 0 }, { "SIGPWR", "Power-fail restart" , 0, 0, 0 }, { "SIGWINCH", "Window change" , 1, 0, 0 }, { "SIGPHONE", "Handset, line status change" , 1, 0, 0 }, { "SIGPOLL", "Pollable event occured", 1, 0, 0 } }; eon3122/bibt/tracb.H000644 000000 000001 00000001212 05710535120 014402 0ustar00rootother000000 000000 #ifdef MSDOS #define TMP_DIR "" #else #define TMP_DIR "/tmp" #endif #define TRACE_EXT ".x" /* log file for exceptions */ struct call_args { char* arg_name; char* arg_value; struct call_args* next; }; extern "C" { struct call_args* _make_arg_list (char *, ...); void _enter_routine ( void*, char*, char*, struct call_args*); void _leave_routine(); void _trace_back(int); void _trace_write_log ( char *, char *, void *, int, char*, char*, char*, char*, int, int); /* Also in ert.H */ void _trace_end_log ( int); void _ert_open_trace ( char *), _ert_close_trace (); void _ert_memory_error ( char*, int); /* Also in ert.H */ } eon3122/demos000755 000000 000001 00000000000 05710535123 013315 5ustar00rootother000000 000000 eon3122/demos/hello000755 000000 000001 00000000000 05710535124 014421 5ustar00rootother000000 000000 eon3122/demos/hello/hello.e000666 000000 000001 00000002430 05710535123 015753 0ustar00rootother000000 000000 -- -- Simple test class with a few token tests -- indexing description: "Eon/Eiffel startup system"; class HELLO inherit HELLOP rename supply_number as supply_seven end creation make feature i:INTEGER make is -- A very simple procedure local err:BOOLEAN h:HELLOP do err := False !!codes.make(1, 10) !!h set_numbers codes.put ( 5, 5) codes.put ( 6, h.supply_constant) codes.put ( 7, supply_seven) codes.put ( 8, supply_number) from i := 1 until i = 8 or err = True loop if i /= codes.item ( i) then err := True end -- io.putint ( i) -- io.putstring ( "/") -- io.putint ( codes.item ( i)) -- io.newline i := i + 1 end if err = True then io.putstring ( "Self test failed at point ") io.putint ( i - 1) io.putstring ( "!%N"); else io.putstring ( "Eon/Eiffel appears to be installed and running%N") end end -- class is make codes:ARRAY[INTEGER] feature { NONE } set_numbers is -- If we don't recognise infix operators such as `+', the database -- wasn't correctly initialised. do codes.put ( 1, 1) codes.put ( 1+1, 2) codes.put ( 1+3-1, 3) codes.put ( 2*2, 4) end supply_number:INTEGER is 8 end -- class HELLO eon3122/demos/hello/hellop.e000666 000000 000001 00000000254 05710535124 016136 0ustar00rootother000000 000000 -- -- Supply hello with a few features that it can redefine -- class HELLOP feature supply_constant:INTEGER is 6 supply_number:INTEGER is do Result := 7 end end eon3122/demos/hello/hello.l000644 000000 000001 00000000160 05710535124 015755 0ustar00rootother000000 000000 root HELLO creation make option debug(all) trace(all) debug(on) trace(on) generate executable:"hello" eon3122/docs000755 000000 000001 00000000000 05710535111 013133 5ustar00rootother000000 000000 eon3122/docs/app-a000644 000000 000001 00000004336 05710535110 014140 0ustar00rootother000000 000000 .hc 6 ENVIRONMENT VARIABLES .h 6.6 ENVIRONMENT VARIABLES TO CONTROL COMPILATION 6.1.1 TMP / TEMP / EON_TMP Where to place temporary files. Each of these is tested in turn. If none are found temporary files will be placed in @[/tmp] for Unix systems and the current directory for MSDOS. For example: TMP=/tmp TEMP=/tmp EON_TMP=/tmp 6.1.2 EON_COMPILER Select the @{C++} compiler to be used. This will override the use of the default @[eon.cfg] file. For example: EON_COMPILER=gnu 6.1.3 EON_LIMITED_MEM (MSDOS ONLY) On machines where system resources are limited, problems may occur. This option attempts to limit the use of resources by closing files when they are not need and reopening later. For example: EON_LIMITED_MEM=1 6.1.4 USER (MSDOS ONLY) The database tracks the user responsible for creating @{classes}. On single user MSDOS machines, this variable allows a name to be specified. 6.1.5 EON Specify the location of the Eon/Eiffel Universe. 6.1.4 EON_NO_UNIX_ARGS (MSDOS) By default the various Eon/Eiffel tools understand Unix style command line options, for example: eon -v1 file set EON_NO_UNIX_ARGS=1 changes this behaviour and forces the use of / switches .h 6.2 ENVIRONMENT VARIABLES TO CONTROL SYSTEM EXECUTION 6.2.1 EON_TRACE Enable function tracing at runtime. This assumes the system was compiled with TRACING turned on). This variable has two levels, 1 and 2. Level 1 will only display function names. 2 will display the contents of parameters passed to functions. See the section on DEBUGGING 6.2 EON_ASSERT Enable assertion checking at run time. This assumes the system was compiled with the relevant assertions turned on. This variable can be set to a number of different letters, (r, e, i, l, c, n and a). For example: EON_ASSERT=rei EON_ASSERT=reilc EON_ASSERT=a EON_ASSERT=n These are explained in the section on DEBUGGING. 6.2 EON_DEBUG Enable debugging statements at runtime. This assumes the system was compiled with DEBUGGING turned on. See the section on DEBUGGING. eon3122/docs/app-b000644 000000 000001 00000004114 05710535110 014133 0ustar00rootother000000 000000 .hc 7 TROUBLESHOOTING This section is divided up into three parts, general problems, MSDOS specific and Unix specific. .h 1 General .h 1.1 I am getting messages complaining about the use of @[bool] from the @{C++} compiler. * Part of the new ANSI standard requires that @[bool] is a built in type. If your compiler does not support this you will need the line -DNEEDS_BOOL added to the cflags line in the configuration file. The reverse may also be true in that your compiler (an upgrade perhaps) has the bool type and you have -DNEEDS_BOOL in the configuration file. If you have -DNEEDS_BOOL, remove it. If you don't then added. .h 1.1 I am getting messages complaining about the use of inlines from the @{C++} compiler. * The ANSI standard on the use of inlines (which are an optimisation feature) is being tightened up. Add -Ei to @[ec2 flags] in the configuration file. .h MSDOS/WINDOWS .h 2.1 The compilations run very, very slowly on MSDOS. * Eon is compiled with DJGPP, a 32 bit compiler that is not limited by MSDOS conventional memory space, it can use extended memory. If DJ's runtime (called go32) runs out of memory it will swap to disk (slow). If you have not got a memory manager running things will slow down, especially the @{c++} compilation phases (if you are using DJGPP as the back end compiler). Read the file djgpp.doc for hints on how to start a memory manager. Your MSDOS book will have more information. If you are running Windows you will already have a memory manager and the problem is elsewhere. * Are you running smartdrive or another disk caching program? If not you will gain a lot of all round by using one. .h 2.2 I see error 4 or messages like @[Can't open file] * You haven't got enough file handles. Increase the FILES entry in CONFIG.SYS. Currently, this needs to be at least 50 .h Every so often, a compilation just hangs. * Are you using a version of DJGPP that is earlier that 1.12? If so, this might be due to a bug that caused the C system() call to hang. An upgrade is well worth it. eon3122/docs/app-c000644 000000 000001 00000001300 05710535111 014127 0ustar00rootother000000 000000 .hc 7 DOCUMENT VIEW Documentation can be either viewed via @[vdoc] or printed. @[vdoc] has a help screen that describes which keys can be used. It is "hypertext" like in that certain words can be used as a search key. These are highlighted in green. The cursor can be moved to such words (via the LEFT and RIGHT arrow keys). By pressing ENTER a pick list appears and associated topics can be chosen. The documentation can be printed using the 'P' key when using @[vdoc]. Printing is controlled via a configuration file called @[printer.cfg] This file may have to be tailored for individual printers or stationary Other files associated with @[vdoc] are @[default/vdoc.hlp] and @[Keys.dat]. eon3122/docs/contents000644 000000 000001 00000000130 05710535111 014764 0ustar00rootother000000 000000 @[EON/EIFFEL] Version @$version .menu eon3122/docs/overview000644 000000 000001 00000006343 05710535111 015011 0ustar00rootother000000 000000 .hc 1 ABOUT EIFFEL Eon/Eiffel is an implementation of the programming language @[Eiffel 3] as described in the book @[Eiffel - The Language by Bertrand Meyer]. If you have not met Eiffel before, it is a new language based on a the notion of Object Orientated programming. This technique is not new, it's roots go back several decades but it has found new life in a world where the issue of software quality is becoming the focus of attention. In simple terms, an object becomes a building block. If a programmer can construct a program out of existing blocks a triple advantage is gained; the software is reliable if it is built from well used fully developed modules; it is cheap because less code is written and it is maintainable because each module is small, manageable and insulated from other modules. On a pure programming level, Eiffel defines a programming language suitable for construction of each object, but more importantly it defines how the modules are to be interfaced together. In fact not only does it define how the modules are put together, it makes sure that they are put together properly. On the more managerial side of things, it is important that one programmer should be able to build upon the work of others. To this end, the way in which an module is to be used is automatically documented and made available to others via a set of tools. If a module is available for a particular job but needs modification, Eiffel allows it to be reused in such a way that it does not interfere with other users of that module. Thus in Eiffel we have a language that promotes software reliability via reuse and correct design. .h 1.1 ABOUT EON/EIFFEL Most implementations of the Eiffel language (and indeed many other languages) produce C code which is then compiled. This is a sensible approach because advantage can be taken to C's portability and by using a C compiler that is native to the target computer, fully optimised code can be generated. Eon/Eiffel generates @{C++} output, something that can be done now that @{C++} is available on a wide range of machines and the language has settled down. There are three reasons for the choice of @{C++}. It has much in common with Eiffel and it's ability to handle @{classes} with inheritance simplifies the code generated by the Eon compiler. Secondly, @{C++} compiler vendors have put much effort into producing product that handles objects and @{classes} efficiency - a somewhat difficult task. We can take advantage of that work. Final, @{C++} is becoming an industry standard with companies like Microsoft producing the Windows interface in @{C++}. We are working towards a seamless @{C++} interface so such products can be used with the minimum of difficulty. Practical problems have meant that not all aspects of the Eiffel language are implemented as indicated in the book. However as the product (and indeed the language) develop we hope descrepences will be removed. .h 1.2 ABOUT THIS MANUAL THIS MANUAL does not attempt to describe the language or the concepts behind it. A list of recommended reading for novices and experts can be found in the section entitled @[More About Eiffel]. It describes how to build an Eiffel system once the basics of the language are understood by the programmer. eon3122/docs/refer000644 000000 000001 00000064457 05710535111 014260 0ustar00rootother000000 000000 .hc 4 USER MANUAL .h 4.1 @{CLASSES} @{Classes} are the building blocks of an Eiffel system. Each must be part of a cluster and is therefore strongly related to that cluster. A @{class} name must be unique within a cluster, however different clusters may have @{classes} with duplicate names. This should be avoided if possible since it is bound to end in confusion if such clusters are used in the same system. Each @{class} is described in a source code file with a .@{e} extension. If the @{class} name does not match the file name, a compilation error will result. If the compiler is being run on a case sensitive file system ( such as Unix) the following rules must be observed. @{Class} names must be in upper case, failure to follow this rule will lead to compilation errors. These restrictions are due to the compiler executives ability to determine which @{classes} are required for a given system without the need for complex @[makefile] like instructions. Such rules speed up the process of tracking down source code files from there corresponding @{class} names. More information about @{classes} is given in the section on CLUSTERS. .h 5.2 ROOT @{CLASSES} NOT WRITTEN .h 5.3 CLUSTERS A cluster is a group of clusters that have some commonality. It is physically represented by a directory that contains the source code of the @{classes} plus other files required to make the cluster usable. Example: .../eon/basic/ COMMENT comparab.e general.e numeric.e std_files.e any.e core.e in_stream.e out_stream.e string.e array.e file.e io_stream.e platform.e This directory structure shows the @[basic] cluster similar to that shipped with Eon/Eiffel. * The clusters name is taken from the name of the directory. * The @{class} source code (.e files) are create and edited in the cluster directory. * The cluster may be commented by including the (optional) @[COMMENT] text file. (SEE REF-CLUSTCOMMENT) After the cluster has been compiled it will look something like this. The file extensions will, of course, vary for different @{C++} compilers. .../eon/basic/ COMMENT core.t general.cc io_stream.e std_files.H ERXXX.OTD except.H general.e io_stream.t std_files.cc alias.dir except.cc general.t out_stream.H std_files.e any.H except.e hashable.e out_stream.cc std_files.t any.cc except.t in_stream.H out_stream.e string.H any.e file.H in_stream.cc out_stream.t string.cc any.t file.cc in_stream.e platform.H string.e core.H file.e in_stream.t platform.cc string.t core.cc file.t io_stream.H platform.e core.e general.H io_stream.cc platform.t Not all of these are directly related to @{class} files. A cluster can contain C or @{C++} files, although this is unusual. In this case they form part of the Eon/Eiffel runtime system. The file types are detailed below: .@{e} @{class} source code .@{t} AST file produced by the Eiffel compiler .cc @{C++} source code. This may me produced by the Eiffel compiler or may be written by the programmer .h @{C++} header file associated with the corresponding .cc file .a A library archive of all the object files. MSDOS users are more likely to see a @[.lib] extension ERXXX.OTD Directory for .o files. There may be several of these depending on the type of assertions used. If a cluster contains root @{classes}, it may look something like this .../test/ _test.cc test.e test.l test.o test.t test.cc test.H libtest.a test Here we have several other files added: test.l The system description file (Lace) _test.cc The programs root stub. This is generated when a root @{class} is compiled. It contains the C main() routine and will create the root object and call a creation routine. The program will run from this point. test The executable file ( MSDOS users will see test.exe) Note that there is still a library archive even though the only @{class} is a root. This is simply because the @{class} @[test.e] may be used by another program as an ordinary @{class} so it must be treated as such when it is compiled. It can be seen from this example that clusters are not just for libraries, the @{classes} that produce executable programs are also in clusters. The above example shows a @{class} that produces a program in a cluster that are all called @[test]. A slightly more realistic example would be: .../accounts/ purchase.e purchase.l sales.e sales.l stock.e stock.l This is the basis for an accounts system with three programs, @[sales], @[stock] and purchase. When a program's C code is compiled, the cluster directory is specified with the compilers -I option so header files can be located. When the program is linked, the library archive in the cluster directory is specified. Clusters may be created anywhere in a file system and any programs produced need not be located in the cluster. This sort of control is given by the system description file (@[LACE]). A cluster directory may be created and referred to in upper or lower case. However, the compiler will always convert them to upper case internally. Mixing cases in a name may lead to confusion. MSDOS. If a cluster name is greater than 8 characters it is still valid, and will access a directory with the name truncated. This will, of course, give problems if two clusters are similarly named where the first 8 characters are the same. .h 5.4 CLUSTER COMMENTS A cluster may be optionally commented with the inclusion of a text file called @[COMMENT] in the cluster directory. The comment file will be read by the browser and documentation tools. Lines within the file may be text read by such tools or free text. The former begins with the standard Eiffel comments (@[--]). Example: Cluster: Intrinsic -- Basic @{class} library -- Development only -- Incomplete Manifest: array.e comparable.e core.e file.e general.e in_stream.e integer.e io_stream.e numeric.e out_stream.e platform.e std_files.e string.e .h 5.5 DATABASE At the heart of an Eon/Eiffel system lies a database that accumulates information abstracted from Eiffel @{classes}. In practice the programmer need know little about the database itself since it is self maintaining and developing an Eiffel system needs no direct access to it. It may, however, need to be rebuilt (if it becomes corrupted) or moved, and the system manager may want to specify it's location. Since the database contains information that is in the source files, its condition and integrity need not be a major worry. If it is lost it can be rebuilt any time, in fact if it is missing entirely, it will be rebuilt the next time a @{class} is compiled. By database standards it is unlikely to become large, the information stored is quite small. It is basically a set of balanced btree, and a Unix dbm styled data store. It can maintain variable length fields and records and has alternate indexes built on some of the fixed length fields. .h 5.5.1 RELOCATING THE DATABASE By default the Eon/Eiffel compiler uses the name @[class.edb] for the database and looks for it in the following place: /usr/eon - on Unix systems (/usr/eon/class.edb) \eon - on MSDOS systems (\eon\class.edb) This default can be overridden with the environment variable @[EON]. This, in fact, moves more that the database. It controls where the compiler looks for its configuration files and default clusters. Example: To relocate the database to @[/compilers/eon] use one of these commands: EON=/compilers/eon ;; export EON # Unix Bourne/Korn shell setenv EON /compilers/eon # Unix Csh set EON=\compilers\eon # MSDOS .h 5.5.2 DETERMING IF THE DATABASE HAS BECOME CORRUPTED If a compilation is failing (or the compiler crashing) for no obvious reason the fault may lie in the information being retrieved from the database. If the same program has been successfully compiled before, database corruption is the most likely caused. There is no utility for rebuilding the database. Deleting the database directory will cause it to be rebuilt when a @{class} is next compiled. .hc 5.5 DEBUGGING EIFFEL CODE Eiffel: The Language describes a number of debugging options that are supported in Eon/Eiffel. The following are implementation notes that should be read in conjunction to the book. 5.6.1 ASSERTIONS Assertions control is via the system description file ELACE. At runtime, finer control can be achieved via the EON_ASSERT environment variable. If this variable is not defined, all the assertions that were compiled into the code will be checked and acted up if required. EON_ASSERT may be set to one of or a combination of the following: e - ensure r - require i - invariant c - check l - loop a - all n - none In the presence of EON_ASSERT only the specified conditions will be checked. This applies to the whole system. Example: EON_ASSERT=erc Here, only the pre and post conditions (@[ensure] and @[require]) and @[check] statements are acted upon. The must, of course, have been specified in the ELACE file. When an assertion traps an error, a message will be generated and the program aborted. Example: -------------------------------------------------------------- "ARRAY.put": Precondition failed "inside_bounds" AND_THEN ( (lower <= index), (index <= upper)) No Traceback available. -------------------------------------------------------------- If the program was compiled with the trace feature enabled, a traceback will be displayed: -------------------------------------------------------------- "ARRAY.put": Precondition failed "inside_bounds" AND_THEN ( (lower <= index), (index <= upper)) Object @{Class} Routine Arguments -------------------------------------------------------------- 0x004076f0 ARRAY put element="a string" index="100" ============================================================== -------------------------------------------------------------- This shows a condition in which an array element that is outside the arrays limits has been written too. The traceback shows the @{class}, feature and parameters of the call in which the error was trapped. The traceback is, for the most part, obvious. However the display of the functions arguments require further examination because they show a data element for each @{class}. In the example, index=100 clearly indicates the index element to be 100 which is of type INTEGER. The first option, element="a string" is (if we look at the code) of type ANY. This raises the question of how the traceback selects a text string from the supplied @{class}. The @{class} GENERAL defines a function called `out'. This returns a string initialised to "out - not implemented". In order to make the traceback arguments useful, a @{class} must redefine `out' and make it return a string that is relevent to that @{class}. For example FILE would return the name of the file that is open. STRING would (of course) return whatever the current object is being used for. Trace: If the trace option has been enabled, information for a traceback listing is accumulated. In addition a log of functions and procedures is maintained as the they are entered and exited. By setting the EON_TRACE environment variable, a trace is displayed at the start and end of a procedure or function: Example: ------------------------------------- +++ ARRAY.make +++ ARRAY.resize +++ ARRAY.initialise --- ARRAY.initialise --- ARRAY.resize --- ARRAY.make ------------------------------------- The @[+++] symbol indicates that the named function has been entered. The @[---] symbol indicates the exit point. The environment variable EON_TRACE does not require a value, it's existence is tested for. setenv EON_TRACE Unix C shell set EON_TRACE ;; export EON_TRACE Unix Bourne shell set EON_TRACE=1 MSDOS .h 5.6.2 RUNTIME CHECKING OF NULL ENTITIES Under normal circumstances an attempt to access a reference object that has not been created will end in disaster. On Unix a segmentation violation will occur and on DOS anything could happen. Example: -------------------------- str:STRING str := "DISASTER" -------------------------- The correct code, is more like: -------------------------- str:STRING !!str.make str := "DISASTER" -------------------------- To prevent this unfriendly behaviour, the compiler inserts code to abort the program in a more informative way. If possible a traceback is given along with a description of the @{class} being abused. This adds a small runtime overhead however the code can be removed with the optimisation feature. .h 5.7 EON EXECUTIVE The main compiler stages are run from an executive program called @[eon]. This has the complicated task of taking a root @{class} and a system description file and compiling out-of-date dependent @{classes}. It then goes on to produce an executable program. The programmer has various options to control this process. A normal compilation, in which a root @{class} is to be compiled, will perform the following steps: * Read @{C++} compiler definitions file * Locate and open the database (creating and initialising if it does not exist) * Read the lace file for the given @{class} name * Determine a list of out-of-date dependent @{classes} - check inheritance @{classes}. If an ancestor is out of date, include that @{class} and all descendants - check generic information. Include if the @{class} has generic parameters and one of those is out of date - check supplier @{classes} * Rebuild AST files and update database for all out-of-date dependents. This is done for all in before the full compilation stage. Produce .@{t} files. * Perform @{C++} code generation from out-of-date @{classes}. If it was a supplier @{class} this is only necessary if the @{class} interface has changed * Run @{C++} compiler for all required files. This is not the same as just running the @{C++} stage on the out-of-data @{classes}. The task is to build object files from @{C++} source so if the object files have been removed or the @{C++} code changed, this stage still takes place. * Add modified object files to the library. As in the previous stage, this is not just a question of adding out-of-date @{classes}. Any updated object file is added. * Link the final program .h 5.7.1 COMMAND LINE OPTIONS The basic command is a single @{class} name. Example: eon sales eon SALES eon sales.e These will compile the @{class} SALES in the current directory. In each case the source code will be expected to be in the file @[sales.e]. The following options control the way @[eon] works and the output generated. If no options or names are specified, a help message is displayed. -b Build entire cluster. This is an automatic update of each @{class} in a cluster. It does not compile root @{classes} and can be used to compile all source files regardless of their dependency upon others. Example: eon -c /usr/eon/basic -b -c pathname Cluster name for @{class} to be compiled. If this option is not specified the current directory is used. Example: eon -c /usr/accounts sales This compiles the @{class} SALES in the cluster ACCOUNTS found by the path /usr/accounts. -d Describe compilation stages. This option prints a short message at the major points in the compilation so that progress can be observed. Example: eon -d sales -n classname Specify non-root @{class} name. @[classname] is compiled directly rather than part of the compilation process of a root @{class}. This can be useful for syntax checking a @{class} while it is being developed. Example: eon -n string This compiles the @{class} @[string] which is not a root @{class}. Suppliers and ancestors of @[string] will be recompiled if necessary. -p Preserve generated C code files. If the compilation fails for some reason, @{C++} source files are normally deleted. If the error was causes by @{C++} being unable to compile the generated code, this option allows that code to be inspected. Beware, that when @[eon] is rerun it will think that the @{C++} file is up-to-date and not compile it. In such cases delete the @{C++} source file by hand. -r Rebuild the runtime system. If the runtime modules (eiffel_rt & tracb) have been changed, this option will compile the source files and add them to the appropriate library. -u directory name Set universe name. @[directory name] must be set to a directory that contains (or is able to contain) a system database. This option is similar the function served by the EON environment variable when it is used to locate the database. However, the option will relocate the database only, not the configuration files. Example: eon -u /compiler/tmp test The database /compiler/tmp/class.edb is used rather than the main database. -v [1-2] Set level of verbosity. The amount of diagnostic output can be configured to help diagnose problems with the compilation process. Level 1 is the minimum setting. Levels higher than 2 are only really for use in the development of the compiler itself. -z Clean up cluster directory. This option will scan a cluster for any @{class} source code files and delete the associated files that were generated by the compiler. Although this option can be used to create more space on a full disc the files will probably be regenerated when a system using that cluster is compiled. .h 5.7.2 CONFIGURATION When @[eon] first runs, a number of files are read. If any of these are unavailable, they may be created or the compilation aborted. * The database. If a database is not found, a new one is created (after the programmer has been prompted to make sure this is the correct course of action). The database base is initialised and the the basic @{class} library is located and built. This may take some time so copying a fresh database from elsewhere is a better approach. * The system description file (Lace). If @[eon] was run with the intention of compiling an executable program, a Lace file will be required. If there is not one matching the name of the root @{class} specified, the programmer is prompted and a basic file created. This contains the minimum specification and will almost certainly need attention. Example for a @{class} called `test': ----------------------------------- | root | | test | | | | creation | | make | | | | generate | | executable:"test" | | | | cluster | | $(EON)/basic | | | ----------------------------------- * The @{C++} compiler configuration file. If this is missing, @[eon] terminates. .h 5.8 SYSTEM DESCRIPTION FILES The way in which a program is built is governed by a description file, the syntax of which follows that of LACE as described in Eiffel: The Language. Only a minimum subset of LACE is implemented in the current release of Eon/Eiffel, and so a full description follows. Future releases will see proper support for LACE. For this reason we will refer to the current system as ELACE to alert programmers to the descrepences. ELACE files are textual and must have a @[.l] file extension. There general syntax is as follows: root creation option debug():class_name_list, ...... trace():class_name_list, ...... optimise():class_name_list, ...... assertion(ensure):class_name_list, ...... assertion(require):class_name_list, ...... assertion(loop):class_name_list, ...... assertion(invariant):class_name_list, ...... assertion(on):class_name_list, ...... assertion(off):class_name_list, ...... assertion(none):class_name_list, ...... generate executable:"file_name" compile_with: "link_flags" link_with: "link_flags" cluster "cluster_name" "cluster_name" There are five sections as described below: @[root] name the root @{class} to be of the program to be compiled @[creation] name the creation procedure to be called in the root @{class}. This is a normal Eiffel creation procedure and must, therefore, be named in the creation clause of the root @{class}. @[option] specify Eiffel compilation options. These handle standard Eiffel debugging and efficiency controls. There are implementation differences which are documented in the section on debugging. @[generate] include extra options for the @{C++} compiler and linker for a particular system. These are extra to those specified in the @{C++} compiler interface file. @[cluster] name clusters required by the system. These names may include environment variables in the form of: cluster "$(EON)/basic" "$(MYCLUSTER)/basic" Example: root SALES creation init_sales option debug(on):SALES, CUSTOMER, STOCK trace(on):SALES assertion(ensure):SALES,STOCK assertion(require):SALES,STOCK generate executable:"$(ACCOUNTS)/bin/sales" link_with: "-lcposix" cluster "$(EON)/basic" "$(ACCOUNTS)/accounts" The examples shows part of an accounts system. A program called sales is is compiled and saved in $(ACCOUNTS)/bin. Its root @{class} is SALES and, when run, the first procedure called is @[init_sales]. There is debugging control on @{classes} SALES, CUSTOMER and STOCK. .hc 5.9 NAMING CONVENTIONS This section describes some of the terminology that is specific to Eiffel. .h 5.9.1 CONVENTIONS USED IN THE LANGUAGE System: In Eiffel terminology a @[system] refers to a group of @{classes} put together to produce a single executable program. Thus a system will have, at runtime, one or more objects. There is always a special object, called @[the root] that is the entry point into the system. Cluster: A cluster is a group of @{classes} that are considered to be related in some way. In physical terms, a cluster is a directory containing @{class} source files. Cluster names are case in-sensitive. Universe: When a system is defined it will require one or more clusters from which to draw @{classes}. This is said to be the universe for that system. A universe is defined in a Lace file for a given system. @{Classes}: All @{class} names used in Eiffel source code should be in upper case. Each @{class} name will relate to a source file found in a cluster belonging to the universe of the system being built. A @{class} must have a source code file in the cluster to which it belongs. All @{class} source code files should have a @[.e] extension and be in lower case (assuming the operation system supports uppper and lower case). When a @{class} is defined, it's name must match that of the file it is in. A @{class} name can be up to to 30 characters in length, thereby exceeding the maximum file name length of many operating systems. (MSDOS, for example, only supports file names of up to 8 characters). To overcome the obvious difficulties of readablilty and portability that such restrictions bring, a @{class} name alias feature is available. This file contains a list of @{class} names and their associated file names. Example: basic/alias.dir -------------------------- | LINKED_LIST link_lst | | ASCII_WINDOW awindow | -------------------------- LINKED LIST and ASCII_WINDOW are @{class} names and link_lst and awindow are their corresponding file names. If a @{class} name appears twice in a system a warning will be displayed when the system is compiled. Note: When a root @{class} is compiled, a stub program is produced which :: variables: Variable names are not case sensitive. .h 5.9.2 CONVENTIONS USED IN THE DOCUMENTATION The documentation uses Unix conventions and styles. Most MSDOS @{C++} compilers support similar conventions even if the operation system does not. @[Path names] Path names given as MSDOS \ characters are converted to Unix / format throughout. File names of greater than 8 characters will be truncated on MSDOS. @[Environment] Environment variables are accessed via a $ leadin character where applicable: Example: $(EON) can be used to substitute the EON environment variable. This applies to MSDOS and Unix. eon3122/docs/system000644 000000 000001 00000014474 05710535111 014473 0ustar00rootother000000 000000 .hc 2 THE EON/EIFFEL SYSTEM Many traditional languages allow much freedom in the way source code is managed. The tools to manipulate such languages are disparate and come from many sources. Eon/Eiffel is not like this, the structure is rigid because all the functions of program generation are handled by one program ( the compiler executive program - eon) and this expects things to be in a logical system. Below is a brief introduction to the elements of an Eon/Eiffel system. As stated earlier, knowledge of Eiffel is required, the following should be used to put the basic concepts into the context of Eon/Eiffel. Terms used in the rest of the manual are defined here. .h 2.1 THE EON/EIFFEL DATABASE One of the features of Eiffel is its typing system, usage of function calls and variables are carefully check for correct use. This means that the compiler must have access to a lot of information about the system being produced. To accommodate it's requirements a central database is maintained, and this provides the central repository of data not only for the compiler but for the browser and documentation tools. For more information on the location and maintenance of the database, see DATABASE .h 2.2 @{CLASSES} The building blocks of Eiffel are @{classes}. In Eon/Eiffel one @{class} is defined per source code file and the name of that @{class} is expected to match that of the @{class}. This helps the compiler (and the programmer) locate a @{classes} source code when required. As in the language definition, a @{class} name must be in upper case letters. The file name should be in lower case with a file extension of @[.e]. All programs consist of a number of @{classes}, all of which have a specific relationship to one another. Each program contains one @{class} that is special because it is the one that is called when the program is first run. This is know as the @[root] @{class}. Other @{classes} may be @[descendants] or @[parents] of a given @{class} if they are part of that @{classes} inheritance relationship. A @{class} may use another @{class} as a variables @[type]. Each will be the others @[supplier] or @[client] depending on which way around their relationship is. It is the way in which a @{class} is used that determines which of the above type it is, not anything particular about that @{class}. Thus a @{class} may be a @[root] in one program but something else in another. .h 2.3 CLUSTERS A cluster is the collective term of a group of Eiffel @{classes}. Since it is a objective of the language that code should be reused, it is important that existing code should be easily found. The most basic step to achieving a well ordered set of source code is to save @{classes} that have something in common in groups or clusters. For more information on the way clusters are physically implemented, see CLUSTERS. The way clusters are setup and used is described in the sections EON, LACE, BUILDING A SYSTEM .h 2.4 AST FILES Abstract Syntax Trees form a fundamental part of Eon/Eiffel. The precise nature of the these is unimportant to the programmer but a basic understanding will help in understanding how the system works. The first phase of the compilation process is to read the source of a given @{class} and check for basic syntax errors. As the file is read, the code is read into a tree structure in memory and then transferred to to a disc file ( the @{class} name with a @[.t] file extension). The second compiler phase reads this file and extracts the information it requires. Sections of the tree are stored in the database (currently only code relevant to pre and post conditions). When the compiler needs to refer to the source code from an inherited @{class}, it need only access the database. These sections of the source code are also available to be viewed by programmers via the browser and documentation tools. The AST file is not readily viewable and therefore provide a way of producing @{classes} that can be compiled without the actual source code. If the .@{e} (class source) file is missing but a .@{t} (AST) is present, the latter will be used for the compilation. .h 2.5 DEFINING A SYSTEM A software project is commonly called a @[system]. This implies that a number of executable programs are generated from a variety of different @{classes} drawn from a number of clusters. Given the multiple usage of @{classes} and clusters we must be able to define how a particular program is to be generated. This is the job of the @[system description file]. It contains information on how @{classes} are to be assembled. Eon/Eiffel's system description file is based on @[Lace] as described in @[Eiffel: The Language] but is only a small subset of it. Future releases will see a closer adherence to the standard. .h 2.6 THE EXECUTIVE COMPILER The generation of an Eiffel program can be a complex business. The @[Lace] file must be read, @{classes} located and compiled (if required) and then the C output compiled and linked. There are several stages to each compilation and a variety of ways the programmer can customise the output. All this is handled by a single program called @[eon]. This is know as an executive compiler because, rather that perform compilation itself, it calls the appropriate tools when they are needed. .h 2.7 THE BROWSER As mentioned above, if a language whose objectives are reliability through reuse of components it is crucially important that a programmer should be able to find what components are available. Since all the required information is stored in the main database, all that is required is a tool that allows the programmer to either look something up or just browse through a list of what is available. For this purpose Eon/Eiffel has a database browser. Eiffel contains a language structure called @[indexing] that allows the conciencious programmer to enable others to locate @{classes} via a set of keys. This information is stored in the database but the current release of the browser can not make use of it. This deficiency will be corrected in a future release. .h 2.8 THE DOCUMENTING TOOLS When a programmer uses a @{class}, he or she will have little interest in the actual coding of that @{class} only the way it is to be used and what procedures are available within it. This is known as the @[interface]. A documenting tool called @[short] allows the interface of a @{class} to be displayed or printed. eon3122/docs/user000644 000000 000001 00000000054 05710535111 014112 0ustar00rootother000000 000000 .hc 3 CREATING A SYSTEM NOT WRITTEN eon3122/credits000755 000000 000001 00000000000 05710535124 013644 5ustar00rootother000000 000000 eon3122/credits/README000644 000000 000001 00000002141 05710535124 014601 0ustar00rootother000000 000000 Credits ~~~~~~~ A number of public domain software products have been used in Eon/Eiffel. They have been used in accordance with the authors wishes and with appreciation for their work. All are available from internet archive sites. 1. The parser stage of Eon/Eiffel was produced with the Cocktail toolkit developed by Dr. Josef Grosch. This is a lex/yacc replacement with extra features. See the "cocktail.txt" file. This package can be found by searching the internet for "cocktail". 2. The MSDOS Shareware version of Eon/Eiffel is produced with DJ Delorie's port of the Gnu C compiler. This can be obtained by searching the internet for "djgpp". 3. The Linux Shareware version of Eon/Eiffel is produced with the Gnu C compiler. This can be obtained by searching the internet for "gcc". 4. Binary tree routines were written by Marcus J. Ranum and can be found by searching the internet for "b+tree". Since this is not as widely available as the above products, send email to eon@eonsw.demon.co.uk for more information. eon3122/credits/cocktail.txt000644 000000 000001 00000023335 05710535124 016263 0ustar00rootother000000 000000 This is to announce that professional support for Cocktail is now available from its main creator. What is Cocktail? Cocktail is the Compiler-Compiler Toolbox developed at GMD Karlsruhe. The Cocktail tools lay emphasis on practical usability and efficiency. The tools generate compiler parts out of specifications that are as ef- ficient as hand-written ones. The use of tools significantly reduces the construction effort and increases the reliability of the generated com- pilers. The toolbox supports almost all phases of compiler construction by more or less independent tools that generate C, C++, Modula-2, or (in part) Eiffel source code. Cocktail runs on all variants of Unix, as well as under Linux, MS-DOS and OS/2 and contains the following main tools: - Rex scanner generator - Lalr LALR(1) parser generator - Ell LL(1) parser generator - Ast generator for abstract syntax trees - Ag generator for attribute evaluators - Puma transformation of attributed trees using pattern matching Support for Cocktail Support for Cocktail is available in two forms: First, users of Cocktail can be supported with activities such as: - Consulting - Training - Maintenance - Updates - Development (e. g. new target languages, modified or new tools) - Research Second, application projects using the Cocktail toolbox can be carried out. This will be projects which in general involve some kind of language processors such as: - Compilers (for standard languages or special purpose languages) - Compiler Parts (grammars e. g. for Fortran 90 or Cobol 85, Syntax-Analyzers, Front-Ends, Code-Generators) - Language Design - Source-to-Source Translators (e. g. Modula-2 to C) - Dialect Conversion (e. g. DEC-Fortran to ANSI-Fortran) - Programming Convention Checkers - Software Complexity Measures ... Maintenance Software maintenance includes new releases of the software, new versions of the documentation, description of updates, and processing of written trouble reports or suggestions over a period of 12 months. I will reply to written reports with a written response and correct reproducible er- rors within a reasonable time. On request, hot-line service can be of- fered. Legal Status Cocktail has been developed during the last years at the Karlsruhe sub- sidiary of GMD - the German National Research Center for Computer Sci- ence. Although Cocktail was supplied in the past with the complete source code, it is copyrighted software, not public domain. Cocktail as well as its output could be used for any purpose, whether education, research, or commercial application. The Cocktail toolbox was unsup- ported software - without warranty and maintenance. GMD assumed no responsibility for the use or reliability of its software. All versions of Cocktail up to Version 9309 can still be used under these conditions - as unsupported software. Now Cocktail will be professionally supported by its main creator. Fu- ture versions of Cocktail will be distributed under a license agreement. There will be two kinds of license agreements: The commercial license allows the use of Cocktail and of its output for any purpose, whether education, research, or commercial application. The research license allows the use of Cocktail and of its output only for non-commercial usage such as education and research. The licenses allow the use of Cocktail on any platform and from any number of users within one site. Maintenance is available for Cocktail from Version 9401. Products The table below lists the available software. The Cocktail tools are available either as single tools or as the complete toolbox. Several tools come with support programs: For example the scanner generator rex is distributed with the programs rpp, l2r, and r2l. The library reuse and the collection of scanner and parser specifications "specs" is au- tomatically included with every tool. The tools are distributed in the form of obfuscated C sources thus guaranteeing portability over a wide range of platforms. The software is supplied with documentation in machine-readable formats: Postscript, troff, or ASCII. On request, docu- mentation can be supplied on paper. Product Description cocktail Compiler-Compiler Toolbox rex Scanner Generator lark LR(1) Parser Generator with Backtracking lalr LALR(1) Parser Generator (will be replaced by lark) ell LL(1) Recursive Descent Parser Generator ast Generator for Abstract Syntax Trees ag Generator for Attribute Evaluators puma Transformation of Attributed Trees based on Pattern Matching reuse Library of Reusable Modules specs Example Grammars for Cocktail for: Ada, C, C++, Modula-2, Modula-3, Oberon, Oberon-2, Occam, Pascal, Sather, Sql rex Scanner Generator rpp Rex PreProcessor l2r Transforms Lex input to Rex input r2l Transforms Rex input to Lex input lalr LALR(1) Parser Generator bnf Transforms Grammars from Extended BNF to Plain BNF lpp Lalr PreProcessor y2l Transforms Yacc input to Lalr input l2cg Transforms Lalr input to Ag input lark LR(1) Parser Generator with Backtracking bnf Transforms Grammars from Extended BNF to Plain BNF lpp Lark PreProcessor y2l Transforms Yacc input to Lark input l2cg Transforms Lark input to Ag input ell LL(1) Recursive Descent Parser Generator ast Generator for Abstract Syntax Trees ag Generator for Attribute Evaluators puma Transformation of Attributed Trees based on Pattern Matching reuse Library of Reusable Modules src Library of Reusable Modules in Modula-2 c Library of Reusable Modules in C specs